KEGG   Escherichia marmotae: C1192_14995Help
Entry
C1192_14995       CDS       T05353                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ema  Escherichia marmotae
Pathway
ema00564  Glycerophospholipid metabolism
ema01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C1192_14995
Enzymes [BR:ema01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C1192_14995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AUT28270
LinkDB All DBs
Position
2882504..2884009
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEITRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYTWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAETINDLGEDFGHEFYEAELKYLVDHEWVRRTDDALWRRTKQGMWLNAE
QQSRMSQWLVEYTQQRLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctaatgctggaagcgcaggatctcgcttgtgcg
acatcttccgccagttcaaaactcattcacggtggcctgcgttaccttgaacactatgaa
ttccgtctggtcagcgaggcgctggcagaacgtgaagtgttgctgaaaatggccccgcat
atcgctttcccaatgcgttttcgcctgccgcatcgcccgcatctgcgtcccgcgtggatg
attcgcattggtctgtttatgtacgatcatttgggtaaacgaaccagcctgccgggatca
accggtttgcgttttggcgcaaattcagtattaaaaccggaaattacgcgcggattcgaa
tattccgactgttgggtcgacgacgcccgtctggtattagccaacgcccagatggtcgtg
cgtaaaggcggcgaagtgcttacccgtactcgtgccacgtctgcccgccgcgaaaacggt
ttgtggattgtggaagcggaagatatcgataccggcaaaaaatatacatggcaggctcgc
ggcctggttaacgccaccggtccgtgggtgaaacagttcttcgacgaaggaatgcatctg
ccttcaccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgtgtgcat
acccagaaacaagcgtacattctgcaaaacgaagataaacgtattgtgttcgtgatcccg
tggatggatgagttttccatcatcggcaccaccgatgtggaatacaaaggcgatccgaaa
gcagtgaagattgaagagagcgaaataaattacctgctgaaggtgtataacgcgcacttt
aaaaaacagttaagccgtgacgatatcgtctggacttactccggcgtgcgtccgctgtgt
gatgatgaatccgactcaccgcaggcaatcactcgtgattacacgctcgatatccatgat
gaaaacggcaaagcaccgctgctgtcggtatttggcggcaagctgacgacctatcgtaaa
ctggcggaacacgcgctggaaaaactgacgccgtattatcagggtattggcccggcgtgg
acgaaagagagcgtattacctggtggagccatcgaaggcgaccgcgacgactacgcagcc
cgcctgcgccgccgctatccgttcctgactgaatcgctggcacgtcattacgcacgtact
tacggcagcaacagcgaactgctgctcggcaatgcggagacgataaacgatctcggggaa
gatttcggtcatgagttttacgaagcggagcttaaatatctggttgaccacgaatgggtc
cgccgcaccgatgacgccctgtggcgtcgcacgaaacaaggcatgtggctgaatgcagaa
caacaatctcgcatgagtcagtggttggtggagtatacgcagcagaggttatcgctagcg
tcatga

DBGET integrated database retrieval system