KEGG   Escherichia marmotae: C1192_21110Help
Entry
C1192_21110       CDS       T05353                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ema  Escherichia marmotae
Pathway
ema00010  Glycolysis / Gluconeogenesis
ema00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ema00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C1192_21110
   00500 Starch and sucrose metabolism
    C1192_21110
Enzymes [BR:ema01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     C1192_21110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AUT29328
LinkDB All DBs
Position
complement(4126768..4128207)
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDALFDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPEMKVGC
MLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGD
LNVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgcc
catcaggtcgaaggcggctggaacaaaggcggcaaagggccaagcatttgtgacgttctg
accggcggcgcacacggcgtaccgcgcgaaatcaccaaagaagtcttgccaggcaaatac
tatccgaaccatgaagcggtagatttttatggtcactataaggaagacatcaagctgttt
gccgaaatgggcttcaaatgttttcgtacttccatcgcctggacgcgcattttcccgaaa
ggcgatgaagcccagcctaatgaagaagggctgaagttttacgacgccctgttcgatgaa
ctgctgaaatacaacattgaaccggtgatcaccctttctcactttgaaatgccgctacat
ctggtgcagcaatacggcagttggaccaaccgtaaggtggttgatttctttgtacgtttt
gctgaagtggtgtttgaacgctataagcacaaagtcaaatactggatgaccttcaacgag
attaacaaccagcgtaactggcgcgcaccgctgtttggctattgctgctctggcgtggtt
tataccgaacatgaaaatccagaagagacgatgtaccaggtgctgcatcatcagtttgtt
gccagcgccctggcggtgaaagcggcacgtcgcatcaacccggagatgaaagtcggttgt
atgctggcaatggtgccactttatccttactcctgtaacccggacgatgtgatgttcgcc
caggaatcgatgcgcgaacgttatgtctttaccgatgtgcaactgcgcggctattacccg
tcctatgtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagatggcgat
ctgaatgtactgcgcgaaggcacctgcgattatctcggcttcagctattacatgaccaac
gcggtaaaagccgaaggcggcaccggtgatgcgatttctggtttcgaaggcagcgtgccg
aacccatatgtgaaagcctctgactggggctggcagattgatccggtgggtctgcgttac
gcgctctgcgaactgtatgagcgttatcagaagcctctatttatcgtcgaaaacggtttt
ggcgcttacgataaagtagaagaggacggcagcatcaacgatgactaccgcattgattac
ctgcgcgcccacattgaagagatgaaaaaagcggtgacttacgatggcgtcgatctgatg
ggctacacgccgtggggctgcatcgactgcgtatcattcaccaccgggcagtacagcaaa
cgctacggttttatctatgtgaataagcatgacgacggtactggtgatatgtcgcgttca
cgtaagaagagctttaactggtacaaagaggtgatcgccagcaacggcgagaaactttaa

DBGET integrated database retrieval system