KEGG   Escherichia marmotae: C1192_22380Help
Entry
C1192_22380       CDS       T05353                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ema  Escherichia marmotae
Pathway
ema00250  Alanine, aspartate and glutamate metabolism
ema00280  Valine, leucine and isoleucine degradation
ema00310  Lysine degradation
ema00410  beta-Alanine metabolism
ema00640  Propanoate metabolism
ema00650  Butanoate metabolism
ema01100  Metabolic pathways
ema01120  Microbial metabolism in diverse environments
Module
ema_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C1192_22380
   00650 Butanoate metabolism
    C1192_22380
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C1192_22380
   00280 Valine, leucine and isoleucine degradation
    C1192_22380
   00310 Lysine degradation
    C1192_22380
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C1192_22380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ema01007]
    C1192_22380
Enzymes [BR:ema01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C1192_22380
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     C1192_22380
    2.6.1.48  5-aminovalerate transaminase
     C1192_22380
Amino acid related enzymes [BR:ema01007]
 Aminotransferase (transaminase)
  Class III
   C1192_22380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUT29549
LinkDB All DBs
Position
complement(4386600..4387880)
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATKRNGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEISDVRGLGAMIAIELF
ENGDHDKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcgatcccccgtggcgtcggg
caaattcacccgattttcgctgaccgggcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcagtgctcaacaccgggcacctgcatcca
aaagtggttgcagcggtggaagcgcagttgaaaaaactgtcgcatacctgcttccaggtg
ctggcttacgagccgtatctggagttgtgcgagattatgaatcagaaggtgccgggcgat
ttcgccaaaaaaacgctgttggtcaccacgggttcggaagcggtggaaaacgcggtaaaa
atcgcccgcgccgccaccaaacgcaacggcaccatcgcctttagcggtgcgtatcacggg
cgcacgcactacacgctggcgctgaccggcaaggtgaatccgtactctgcgggtatgggg
ctgatgccgggccatgtttatcgcgcgctttacccttgcccactgcatggcatcagtgaa
gatgacgctatcgccagtatccaccgaatcttcaaaaatgacgctgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgccgcgacgccagcc
tttatgcaacgtttacgcgcgctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtccagagcggcgcgggacgtaccggtacgctgtttgcgatggagcaaatgggcgttgca
ccggatctcaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
ggacgtgccgaagtgatggacgccgtcgcaccaggcggtctgggcggcacttatgcgggt
aacccgattgcctgcgtggcggcgctggaagtattgaaggtgttcgagcaggaaaatctg
ctacaaaaagccaacgacctggggcagaaactgaaagacgggttgttggcaatagccgaa
aaacaccctgagatcagcgatgtgcgcgggttgggggcgatgattgcgatcgagttgttt
gaaaatggcgatcacgacaaaccggatgcgaaactcaccgccgagatcgtagcgcgcgcc
cgcgataaaggtctgattcttctctcctgcggcccttattacaacgtactgcgcatcctt
gtccccctcaccattgaagatgctcagatccgtcagggtctggagatcatcagccagtgt
tttgctgaggcgaagcagtag

DBGET integrated database retrieval system