KEGG   Euzebyella marina: D1013_00290Help
Entry
D1013_00290       CDS       T05677                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
emar  Euzebyella marina
Pathway
emar00240  Pyrimidine metabolism
emar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emar00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    D1013_00290
Enzymes [BR:emar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     D1013_00290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AYN65929
UniProt: A0A3G2L104
LinkDB All DBs
Position
complement(60117..60767)
Genome map
AA seq 216 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPMIDIRYDEEM
VVSHDANEIPSTPVPAAANIRILGDTCDVVGIDEAQFFDDEIVTVCNDLANRGVRVVVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAICTRTGNLANYSYRKSSNDSLVLLGETEEYEP
LSRAAFYKAMLKEKVKNMNVEGEELKAKTKNTDAKG
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaacactgttaatcataaagaacaatttggttggatagaagtcatctgc
ggctcaatgttctcgggcaagaccgaagaattgatccgtcgtttgaagcgtgcccaattc
gccaaacaaaaggtagagatctttaagccgatgatcgatataaggtacgatgaagaaatg
gtggtgtctcacgatgcgaatgaaataccgtcgacccccgttccagcggccgctaacatt
cgaattttaggtgatacttgtgatgtagtgggtatcgatgaggcacaattctttgatgat
gagatagtaactgtttgtaatgatttggcaaataggggagttcgagttgtggtagcggga
ttggatatggattttaaaggaaacccgttcggccctatgcccgcgcttatggccacggca
gaatatgtcaccaaggtacacgctatttgtacgcgtacaggcaatttggccaattacagt
taccgaaagtcaagtaatgacagcttggttttattgggtgaaaccgaagaatatgagccc
ttgagccgagccgctttttataaagcgatgctaaaggaaaaagtaaagaatatgaatgtt
gaaggcgaagagctgaaagcaaagactaaaaatacagatgccaaaggctaa

DBGET integrated database retrieval system