KEGG   Euzebyella marina: D1013_06080Help
Entry
D1013_06080       CDS       T05677                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
emar  Euzebyella marina
Pathway
emar00380  Tryptophan metabolism
emar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    D1013_06080 (kynU)
Enzymes [BR:emar01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     D1013_06080 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AYN66972
LinkDB All DBs
Position
1488857..1490122
Genome map
AA seq 421 aa AA seqDB search
MQFENTLSFAKSLDLKDELSDYRSQFHFPKVNNKPVVYFTGNSLGLQPKRTKKFVDEIMA
DWGDLAVEGHFHASKPWWDYHERLAEPLSHIVGAKKEEVCVMNTLTVNLHLLMVSFYRPT
SKRFKILCEEKAFPSDQYMLQSQVRHHGFEPSEALVEVAKRDGEHYWRTEDILAKIEEIG
DKLALVLIGGVNYYNGQVFDMQTITRAGKAVGANVGWDLAHAAGNIELELHEWEVDFAAW
CSYKYMNSGPGNASGIFVHERHLKNDKLQRFEGWWGTKKDTRFLMKPEFESTHTADSWQL
SNPPVLSLAPYLASLEMFDEVGMEKLIKKQKLIVAYLEFVLREIDKETEGSFEIITPADR
GCQLSVFLHGQGRKLFDYLMENGVITDWREPNVIRLAPAPFYCSFEDMYRFGQILKSGIE
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttgaaaatactttgagttttgccaaatcacttgatttaaaagatgaactctcc
gattataggtctcaatttcatttcccaaaggtcaacaataaacctgtagtttattttacg
ggaaattcattaggtcttcaacctaagagaaccaaaaagtttgtagatgagattatggcc
gactggggagacttggccgtggaaggtcattttcatgcctcaaaaccttggtgggactac
catgaaaggttggccgagcctttatcgcatattgtgggtgcaaaaaaggaagaagtatgc
gtaatgaacacgctgaccgtcaatctgcacctattaatggtgtctttctataggccaaca
tcaaagaggttcaaaatactatgtgaagaaaaggcgtttccttccgatcaatatatgttg
caaagtcaggtaaggcatcatggctttgaacctagtgaggcccttgttgaggtggctaag
cgagatggagagcattattggcgaacggaagatattttggccaaaatcgaagagattggc
gataaacttgccttggttttaataggaggtgtcaattattataatggacaagtctttgat
atgcaaaccatcaccagagcgggtaaagcggttggtgccaatgtagggtgggacctcgcc
catgccgcaggaaatattgaacttgaactacatgaatgggaggtagattttgccgcttgg
tgcagttacaaatacatgaacagcgggccaggcaatgcttcgggtatatttgttcacgaa
aggcatttaaagaatgataagcttcagcgctttgaaggttggtggggtaccaaaaaggat
acccggtttttgatgaaaccagaatttgaatcgacccacactgcagattcttggcaattg
agcaacccaccggttctttcattggccccttatttggcttctctagagatgttcgatgaa
gtgggcatggagaagttgatcaagaagcaaaaattgattgtcgcttaccttgagttcgtt
ctgagggaaattgataaggaaaccgaaggatcttttgaaattatcacaccggcagatcga
ggttgccaattatctgtatttctgcacggccagggtagaaagttattcgactatcttatg
gaaaatggagtaattacagattggagagaacctaacgtaattagattggcgccagcacct
ttttactgttcgttcgaagatatgtaccgcttcggtcaaattttaaaaagcggtattgag
cggtaa

DBGET integrated database retrieval system