KEGG   Euzebyella marina: D1013_06315Help
Entry
D1013_06315       CDS       T05677                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
emar  Euzebyella marina
Pathway
emar00620  Pyruvate metabolism
emar00680  Methane metabolism
emar01100  Metabolic pathways
emar01120  Microbial metabolism in diverse environments
emar01200  Carbon metabolism
Module
emar_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:emar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D1013_06315
  09102 Energy metabolism
   00680 Methane metabolism
    D1013_06315
Enzymes [BR:emar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     D1013_06315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AYN67013
LinkDB All DBs
Position
1535979..1538528
Genome map
AA seq 849 aa AA seqDB search
MQQQDEKLNEFKKSVNNKFNVYNSLFLNLPYRNIENVGILIPLLLDQCQKGLDSGQNPQE
ILESFFQNYVKIESEKERIDFMFRIIQYVERQVVLYDSVEDAAFPKLQEHRRSLSIPDYF
ELVDKNKSWDKVSKKLSTFSARIVLTAHPTQFYTPAVLDIIDDLRSLILEDRIDDIDVTL
QQLGLTSLLNAEKPTPLDEAKNIIYILRHTYYEAIGELYSYIKSNIRKADFDNHNIMKLG
FWPGGDRDGNPFVTAPITKDVANELRVTLMKCYYNDLKQIQKKLTFKGVQEPIRKLRNNL
YTAMFDASKNVGYEDILQPLLDIRELLVTKYHSLYLKELDFFLDKVKIFKTHFATLDIRQ
DHSKHKLAIETILKQNGLIKETVDELSEKELVDILINKKLELNASDYDEPIVKDTIENIS
QLKDIQATNGEDGCNRYIISNSEDIFSVLFVFGLFRWCGWEREEITFDIIPLFETMKGMD
SSEDTMQTLFDLPEYREHLENRGNNQTIMLGFSDGTKDGGYLKANWNILKTKETLSKICS
KNGIKAIFFDGRGGPPARGGGKTHRFYAAQTKEVANNEIQLTIQGQTITSTYGTKEHFIH
NSEQLLTAGLSNNLFGKENVISRSQRKLIEELSELSFAKYDALKNHEMFIPYLENRSTLK
YYQKANIGSRPGKRGNKKKLELTDLRAISFVGSWSQLKQNVPGYFGIGTAIKTLKDDGRI
NEIKKLYKEVPFFKALMLNSMMSLSKCYFELTSYMKEDKKYGEFWNILHEEYLLSKKMLL
MISGSKVLMENEAVSRESIKIRENIVLPLLVIQQFALQKIGQESDLTELYEKIVTRSLYG
NINASRNSA
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagcaagatgagaaactgaacgagtttaaaaaatcggtcaataataaatttaat
gtctacaatagtctttttctaaacctaccttatcgaaatattgagaacgtaggtattctt
attccgcttttattggatcaatgccaaaaaggattggactccggtcaaaatccgcaagaa
attttggaatcattttttcaaaactatgtgaagatagaatcagagaaagaacgcattgat
tttatgttccggatcattcagtatgttgaacgtcaagtggtactttatgatagtgttgaa
gatgcggcttttccgaaactgcaagagcatcgaagatcgttgagcattcctgattatttt
gaactggtagataagaataagagttgggataaggtctctaagaaattatcgaccttcagt
gccagaattgtattaacggcccacccaacgcaattctatacgccggcagttcttgatatt
attgatgaccttcggtctctgattttagaagaccgtatcgatgatatcgacgtaacgtta
caacaactgggtttaacatcacttttgaatgccgaaaaaccaactcctctagatgaggcc
aagaatattatctacatcctccgacatacttattatgaggctattggtgaattatattct
tatatcaaatcgaatattcgaaaggcagattttgataaccataatattatgaaacttggt
ttttggccaggtggtgatagagatggtaacccgttcgtaactgctccgattaccaaagac
gtagcgaacgagctgcgtgtcactttgatgaaatgttattataatgaccttaagcaaatt
caaaagaagcttaccttcaaaggggttcaagagccgattagaaaactgagaaacaatctg
tacacagctatgttcgatgccagcaagaatgtgggttatgaagatattcttcagcctttg
ctcgacattcgcgaactgttggtgaccaaatatcatagcctttatcttaaagaattagat
ttttttcttgataaggtcaaaatattcaaaacccatttcgctacacttgatatccgtcaa
gatcatagcaagcacaaactggctatagaaaccattctaaagcaaaatggtttgatcaaa
gaaactgtcgatgagctatccgaaaaagagcttgttgatattctgatcaataagaagctt
gagttgaatgcaagtgattatgatgagccgatagtaaaagataccattgaaaacatttca
cagttaaaagacattcaagccaccaatggtgaggatggttgtaaccggtatattattagt
aattcagaggatattttttccgtattgttcgtattcggcctatttagatggtgtggatgg
gaacgtgaggaaataacttttgatatcattccgctattcgaaactatgaagggtatggat
agttctgaagataccatgcaaacccttttcgatttaccggaatatcgtgaacatttagaa
aatagaggtaataaccaaaccatcatgctaggcttctcagacggaacaaaagatgggggg
tatcttaaagccaattggaatattttaaagaccaaagaaaccttatcgaagatttgtagt
aaaaatggaatcaaggccatattcttcgatggccgtggtggaccaccagctagaggtggt
ggcaagacacatcgattctatgccgctcaaaccaaagaggtggccaataacgagattcag
ttgaccattcaagggcagacgattaccagtacctacggtactaaagagcattttattcat
aacagtgagcagcttttgaccgctggtctttccaataatttatttggaaaagagaacgta
atctcaaggtcgcagcgcaaactgatagaagaactttccgaattaagttttgcaaagtat
gatgcccttaagaaccatgaaatgttcattccgtacttggagaatagaagtacattaaaa
tattaccaaaaggccaatattggtagtagaccgggcaaacgcggaaataaaaagaaacta
gaacttacagatcttagagcgatttcctttgttgggtcatggagccaattgaaacagaac
gttcctggctatttcggtatcggaaccgccattaagaccttgaaagatgatggtagaatt
aatgagattaaaaagttatacaaagaagtaccattctttaaggctttaatgctcaatagt
atgatgtcgctttccaaatgctactttgaacttaccagctatatgaaggaggataaaaaa
tatggcgagttctggaatattcttcatgaagagtatttgctgtcgaaaaaaatgttacta
atgatttcgggcagtaaggttcttatggaaaacgaggcagtgtctcgagagtcgattaag
attcgcgaaaacattgtgctaccattattggttattcaacaatttgcactacagaaaatt
gggcaagagtctgatttgaccgagctttacgaaaagattgttacccgttcattgtatggt
aacatcaatgccagtagaaactcggcttaa

DBGET integrated database retrieval system