KEGG   Elizabethkingia meningoseptica: BBD33_05475Help
Entry
BBD33_05475       CDS       T04744                                 

Definition
(GenBank) stearoyl-CoA 9-desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
emg  Elizabethkingia meningoseptica
Pathway
emg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    BBD33_05475
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:emg01004]
    BBD33_05475
Enzymes [BR:emg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     BBD33_05475
Lipid biosynthesis proteins [BR:emg01004]
 Desaturase
  Front-end
   BBD33_05475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AQX04732
UniProt: A0A1V3U025
LinkDB All DBs
Position
1177901..1179007
Genome map
AA seq 368 aa AA seqDB search
MKHPVYPKNTDETHLFNELRKRVNQRVQEIPENRDRYIRIKAVILPIVYFGSYFLAVFNG
DKPWLYIACYIMMGLTLVLIYLNLIHEAAHNNIYKTKKYNKWLLRLFDLIGANSYIWQKR
HIVSHHAYPNVDGWDTDMEQSGPIKIFPHVEAKGVQKYQDKYFIFAYPFYLFNWMLVRDF
RDFFDKRRVIYKAHGESPAAEKVKMIMYKLFYLFYQIAVPVLFMKVSFGLAFGAWVLEIF
VASIFALFVLLPLHPLPDNEYPLPDENNNLPYSWLRHQLEVTNDLSNNNWFIRHILGNFN
FHIAHHLFPNYSYVYYNEITDEIENFARENGFVYKRFPILTALGKHYQLLKYNAHNVPLK
YVFEELDS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacccagtttatcctaaaaatactgatgaaacacatttattcaatgagctgaga
aaacgagtgaaccaaagagtacaggaaataccggaaaacagagatcgatatatccggatt
aaagcggttattctgccaattgtctattttggtagttatttccttgcagtctttaacggt
gataaaccatggctgtatatagcttgctatatcatgatgggacttacactggttttaatt
tacctgaatctgatccacgaagcagctcataataatatttataaaaccaaaaagtataac
aagtggctgctaaggctatttgaccttatcggagccaatagttatatctggcagaaaaga
catattgtaagccaccacgcctatccaaatgttgacggctgggatacagatatggaacag
agcgggcccattaagatctttccacatgtagaagcgaaaggggttcagaaataccaggac
aagtattttatttttgcttatccattctacctgttcaactggatgctggttcgtgatttc
agggatttttttgataaaagaagagtgatttacaaagctcatggagaatcacctgcagct
gaaaaagtaaaaatgattatgtataaattattttaccttttttaccagatagcagttccg
gttttattcatgaaggtttcattcggattagcattcggtgcctgggttttagaaatattt
gtggccagtatttttgcactgtttgtattactgcctttacatccgctgccggataatgaa
tatccgttaccggacgaaaataataatctgccgtacagctggctcagacatcagctggag
gtaaccaatgatttaagcaataataattggtttatacgccacatacttgggaattttaat
ttccatatagcacatcatctgttcccgaattacagctatgtttattacaatgaaataaca
gatgaaatagaaaattttgcccgtgagaatggttttgtttacaaaagattcccaatactc
actgcattgggcaaacattatcaattattaaaatataacgcacacaatgttccgttgaag
tacgtcttcgaggaactggattcctaa

DBGET integrated database retrieval system