KEGG   Elizabethkingia meningoseptica: BBD33_10480Help
Entry
BBD33_10480       CDS       T04744                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
emg  Elizabethkingia meningoseptica
Pathway
emg00564  Glycerophospholipid metabolism
emg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:emg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBD33_10480
Enzymes [BR:emg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BBD33_10480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 Thi4 Pyr_redox_3 HI0933_like NAD_binding_8 FAD_binding_3 GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: AQX05647
UniProt: A0A1V3TZF4
LinkDB All DBs
Position
complement(2284693..2286300)
Genome map
AA seq 535 aa AA seqDB search
MKRKEELEKISQQQEWDFVIIGGGASGLGSALDAATRGFKTLLLESHDFAKATSSRSTKL
VHGGVRYLAQGNIDLVREALFERGLLAKNAAHLVKNQSFIIPNYNWWGGIYYKIGLSIYD
FLAGKLSLGKTRYINKAKTVEKLPTIEQKGLASGVVYQDGQFDDSRLAINLAQTIAENGG
TVVNYTKVVNLLKNENNKITGVVAEDQFTKERYEIKAKAVVNATGVFTNDILNMSNPKHG
KFVVPSQGIHLVLDKSFLKSNDAIMIPKTSDGRVLFVVPWHERALIGTTDTLVDEPSFEP
KALDSEIDFVLSTARQYLSKKPTKEDVLSVFAGLRPLAAPKDGGKSTKEVSRSHKVIVAD
TGLVTITGGKWTTYRQMSEDTIDKAIEVHQLKKIPSKTKDLSIHGNMPASQVDRSNHLYV
YGSDIPAIKALQQEKAEYAERIHPKHEFTVAEVVWAIRKEMAETIEDVLARRVRLLFLDA
RAAIDSARKVAGVFASELGWDEQKTEKEVQDFISLAKGYLLVPYTINDMENNNRN
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaaagaagagcttgaaaagatttcacagcaacaggaatgggactttgtaatc
attggcggtggtgccagtggtttaggttcagctctggatgctgctacaagaggcttcaaa
accttgttactggaatcccatgactttgcaaaagctacttcaagccgaagcaccaaactg
gttcatggaggcgtaagatatcttgcacaaggaaatatagaccttgtacgggaagcattg
tttgaaagaggacttttagctaaaaatgcagcacatctggttaaaaatcagtccttcatt
atccctaactataactggtggggcggtatttattacaagataggattatctatttacgat
tttctggcggggaaacttagtctgggaaaaacaagatatataaacaaagcaaaaacagtt
gaaaaactaccgactatagaacagaaaggtttagccagcggtgttgtttatcaggatggt
cagtttgacgattcgcgtctggccattaaccttgctcaaaccattgcagaaaacggaggt
actgtggttaattacacgaaggtcgttaacctgctgaaaaatgaaaataataaaattaca
ggtgttgttgctgaagatcagtttacaaaagaacgttatgaaatcaaagcaaaagccgta
gtgaatgctaccggtgtatttaccaatgacattcttaatatgagcaacccgaaacacggt
aaatttgttgtaccaagtcagggaattcatttggtactggacaagtctttcttaaagagt
aatgatgctatcatgattcctaaaacgtctgacggcagagttcttttcgttgttccatgg
catgaaagagccttaatagggacaactgatactttagtggatgaaccaagtttcgaaccg
aaagcgctggattccgaaattgatttcgttttgagtactgcaagacaatatttgtctaaa
aaaccgacaaaagaagatgtattatctgtatttgcaggattaagacctcttgctgcacca
aaagacggtggtaaaagcaccaaagaagtttccagaagccataaagttattgtagccgat
acaggtcttgtaacgattacgggcggaaaatggacaacttacagacaaatgtctgaagat
acgattgataaagctattgaagttcatcagctgaaaaaaataccttcaaaaacgaaggac
ctttctattcacggaaatatgccagccagtcaggtagacagaagcaatcacctgtatgta
tatggttcggatattcctgctataaaagcattacaacaagaaaaagcggaatatgctgaa
agaattcacccaaaacatgaatttactgtggctgaagtggtttgggcgatcagaaaagaa
atggcggaaactatagaggatgtactggcgagaagagtaagattacttttcctggatgca
agagccgcaattgattctgcacgtaaagtagccggagtttttgcgagtgaactgggatgg
gatgaacagaaaacagaaaaagaagtgcaggattttatttctttagctaaaggatatctt
cttgtaccttatacaattaacgatatggaaaacaataacagaaactaa

DBGET integrated database retrieval system