KEGG   Elizabethkingia meningoseptica: BBD33_12745Help
Entry
BBD33_12745       CDS       T04744                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
emg  Elizabethkingia meningoseptica
Pathway
emg00010  Glycolysis / Gluconeogenesis
emg00020  Citrate cycle (TCA cycle)
emg00620  Pyruvate metabolism
emg01100  Metabolic pathways
emg01110  Biosynthesis of secondary metabolites
emg01120  Microbial metabolism in diverse environments
emg01130  Biosynthesis of antibiotics
emg01200  Carbon metabolism
Module
emg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:emg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBD33_12745
   00020 Citrate cycle (TCA cycle)
    BBD33_12745
   00620 Pyruvate metabolism
    BBD33_12745
Enzymes [BR:emg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BBD33_12745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AQX06065
LinkDB All DBs
Position
complement(2790123..2791712)
Genome map
AA seq 529 aa AA seqDB search
MAEVITMPRLSDTMTEGKVSKWHKNVGDTVKEGDLLAEIETDKAVQDFESEFNGKLLYVG
VPEGGQAPVDSVLCIIGNDGEDISSLTGGSAAPAKEEAPAPAAAEEPAVTSASAEVPAGV
EIITMPRLSDTMTEGKVAKWHKNVGDTVKEGDILAEIETDKAVQDFESEFNGTLLYQGVA
EGAAALVDNVLAIIGPAGTDVSGLTSGKPAPKQDAAPAAAEKPVATEPKEEVVAATANGD
RVAISPLARKIASDKGIDISAVKGSGDGGRIVKKDVENYQPSAQATKAAATSAPAKAVVN
FVAGEDTETPNSQVRNIIAKRLSESKFSAPHYYLMVEINMDKAIAARKEINSLPDTKVSF
NDMIIKATAIALRKHPQVNSSWAGDKIIHRGNINIGVAVAIPDGLVVPVLKNTDHMSYSE
ISASVKDMASRAKGKGLKANEMEGSTFSISNLGMFGIETFTSIINQPNAAILSVGAIIEK
PVVKDGQIVVGNTMKLSLACDHRVVDGATGAQFLQTLRTYLENPLSLLV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaatcacaatgccgcgtctttcggatactatgacggaaggtaaggtttca
aaatggcataaaaatgtaggcgatacggttaaagaaggagatcttctagccgaaattgaa
acagataaagcggtacaggattttgaatctgaatttaacggtaaacttttatatgttgga
gttcctgaaggaggacaagctccggtagacagcgttttatgtatcattggtaatgatgga
gaagatatctcttcattaacaggaggtagcgctgcaccagcaaaagaagaagctcctgct
cctgcagctgctgaagaaccggctgtaacaagtgcttcagctgaagtgcctgctggtgtg
gaaattatcacaatgcctcgtctttctgatacaatgacagaaggaaaagttgcaaaatgg
cataaaaatgttggtgatacagttaaagaaggtgatatccttgctgaaatcgaaacagat
aaagccgtacaggattttgaatctgaattcaacggaactttattatatcagggtgttgca
gaaggtgctgcagcattagtagataatgtactggctattataggccctgcaggaactgac
gtttccggattaacttcaggaaaacccgctcctaaacaagatgctgcccctgcagctgct
gagaagcctgtggcaacagaacctaaagaagaggttgttgctgcaacagcaaacggagac
agagttgctatttcacctttggcccgtaaaattgcttctgataaaggaattgatatctct
gctgtaaaaggttcaggtgatggcggaagaattgtgaagaaagatgttgagaactatcag
ccttctgcacaagctacaaaagctgctgctacctctgctccggctaaagcagtcgtaaac
tttgttgcaggtgaagatactgaaacaccaaactctcaggttcgtaatattatcgctaag
agactttctgaaagtaaattctctgctccgcattactacctgatggtggaaatcaatatg
gacaaagcaattgctgcaagaaaagaaatcaacagcttaccggatacaaaagtatctttc
aatgatatgatcattaaagctactgctattgctcttagaaagcatccacaggttaacagc
tcatgggcaggtgataaaatcatccaccgtggaaacatcaatattggtgtagctgttgca
attcctgacggattggtagttcctgtattgaaaaatacagaccacatgtcttattctgaa
atttcggcttcagttaaagatatggcgtcaagagctaaaggcaaaggtcttaaagcaaac
gaaatggaaggaagtactttctctatttctaacttaggaatgttcggtatcgaaacattt
acaagtatcattaaccagccaaatgctgcgatcctttcagtaggtgctatcattgagaag
cctgttgtaaaagatggacaaattgtggtaggtaacacaatgaaactttcattagcttgt
gaccacagagtggtagacggagctaccggtgctcagttcttacaaacattgagaacttac
ctggaaaatccgttaagcttactagtttaa

DBGET integrated database retrieval system