KEGG   Elizabethkingia meningoseptica: BBD33_12980Help
Entry
BBD33_12980       CDS       T04744                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
emg  Elizabethkingia meningoseptica
Pathway
emg00020  Citrate cycle (TCA cycle)
emg00310  Lysine degradation
emg00380  Tryptophan metabolism
emg01100  Metabolic pathways
emg01110  Biosynthesis of secondary metabolites
emg01120  Microbial metabolism in diverse environments
emg01130  Biosynthesis of antibiotics
emg01200  Carbon metabolism
Module
emg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
emg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:emg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BBD33_12980
  09105 Amino acid metabolism
   00310 Lysine degradation
    BBD33_12980
   00380 Tryptophan metabolism
    BBD33_12980
Enzymes [BR:emg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     BBD33_12980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AQX06108
LinkDB All DBs
Position
complement(2854010..2856817)
Genome map
AA seq 935 aa AA seqDB search
MDRFSFLNAVHSQFIEDMYQQYLKYPDSLEPSWKAFFQGFDFALENYSDEEAVQEIKSFA
SQAQNSNVNISEISEDIRREFKVINLIEAYRVRGHLFTKTNPVRERRHFEPTLDIENFGL
TSADLNRKFNSATETGMPGPATLSEIIRHLQNIYCDSIGVEYMYIKNVEERDFIRQWLQS
NENHAKLTPEEKKHVLQRLNQAVAFENYLHTKFVGQKRFSLEGLEALIPALDQVITKSSQ
LGVDEVVLGMAHRGRLNVLTNIFQKPYKQIFSEFEGKEFEEDVFSGDVKYHLGASKTIQT
TAGETVNINLTPNPSHLETVASLVEGISRAKVDNTYNGDYNKVLPIIIHGDAAIAGQGIV
YEVAQMMTLDGYKTGGTIHIVTNNQVGFTTNYLDARSSTYCTDVAKVTDSPVMHINADDV
EAVVHAMHFAADFRNRFGKDVYIDLLGYRKYGHNEGDEPKFTQPKLYNIIAKHPNPREIY
KDKLIKEGIVSDEVMKQIEVEFKKLLDINFDESKEIQKNTMDIFMSDDWKKFPFGSRGSV
LNPVDTKYPLDKLKDLAKQISTLPTDKKFIKKITRLFEQRLNMVENDSLDWAMGELLAYA
TLLSEAYNIRISGEDVERGTFSHRHAVVKTEDTEEEYVPLTTVASKDNQFQIYNSLLSEY
AVLGFDYGYAMASPETLTIWEAQFGDFANGAQIIIDQYLVAAEEKWKLQNGLVMLLPHGS
EGQGAEHSSARLERFLTLCANQNIIVANATTPANYFHLLRRQMKSNFRKPLVVMTPKSLL
RHPKAVSKVEELANGTFQPVIDDATAKADKVERLVMCSGKLYYELLAKKEELNDEKVALV
RLEQLYPLQMDQIDAIFQKYANAKEFIWAQEEPENMGAWSYILRSFRERNPQVISPVASG
APAPGSHKKFEINQNAIINQVFQCEGTPSKRPVTA
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggacagattttcattcctaaatgcggtacattctcagtttatagaggatatgtaccag
cagtatttgaaatatcctgacagtctcgaaccatcttggaaagcatttttccaggggttt
gatttcgctttggaaaactacagtgatgaagaagcagtgcaagaaattaaatcttttgca
tcacaggcacagaacagcaatgtcaatatttcagagatttccgaagacattcgcagagaa
tttaaagtaattaatcttatcgaagcctaccgtgttcgtggtcatcttttcactaagact
aatccagtaagagaaagaagacacttcgagcctacgcttgatattgaaaactttggattg
acgtccgctgatttgaacagaaagttcaatagtgctacagaaacaggaatgcctggccct
gcaacactaagtgaaattataagacatcttcagaacatttactgtgactctattggtgta
gagtacatgtatattaaaaatgttgaagagagagatttcatccgtcagtggcttcagtca
aatgaaaatcacgcaaaattaacaccggaagaaaagaaacacgtattacaaagacttaat
caggcagtagcttttgaaaactacctgcatactaagtttgttggtcagaagcgtttctca
cttgaaggattggaagcattaattcctgctttggatcaggtaatcaccaaatcttctcaa
cttggagttgatgaagttgttttggggatggcacacagaggaagactaaatgtattaaca
aatattttccagaagccttacaagcaaatcttcagtgaatttgaaggaaaagaatttgaa
gaagatgtattctcaggtgacgttaaataccaccttggagcatctaaaacaattcagacc
accgcaggtgaaacggtgaatatcaatctaacaccaaacccatctcacctggaaactgtt
gcttctcttgtagaaggaatcagccgtgcgaaggtagacaatacatacaacggagattac
aataaagttttaccaatcattattcatggtgatgctgcaattgccggacagggaattgta
tacgaagtagcacaaatgatgacattggatggttacaaaaccggaggtactatacatatc
gttaccaacaaccaggttggatttacaaccaactatctggatgcccgttcatctacttac
tgtacggatgtggcaaaagttacagattctcctgtaatgcatattaatgcagatgatgtg
gaagctgttgttcacgctatgcattttgctgcagatttccgtaacagatttggtaaagat
gtttatattgaccttttaggatacagaaaatacgggcacaacgaaggtgatgaacctaag
tttacacagcctaaattatacaacatcattgcgaaacaccctaacccaagagaaatttat
aaagataaattgatcaaagaaggtattgtttccgatgaagtaatgaaacaaattgaagtt
gagttcaaaaaattactggacattaacttcgatgagtctaaagagattcagaaaaataca
atggacatctttatgtcggatgactggaagaaattcccgttcggttcaagaggttcagtt
cttaatcctgtagataccaaatacccgcttgataaacttaaagatttagcaaagcagatt
tctactttgcctacggacaagaagtttatcaaaaagattacaagacttttcgaacaaaga
ttaaatatggtcgaaaatgatagtcttgactgggcaatgggagagcttttagcttatgct
acattgttaagcgaagcgtataacataagaatttcaggtgaagacgtagaaagaggtact
ttctctcaccgtcatgccgtagtgaaaactgaagatactgaagaagaatatgtaccgtta
acaaccgttgcttctaaagataatcagttccaaatctataactctttactttctgagtat
gcagttttaggttttgattacggttatgcaatggcttctcctgaaacattaacaatctgg
gaagcgcagtttggtgatttcgccaacggtgcacagattattatagaccagtatcttgtt
gctgctgaagaaaaatggaaactacaaaacggtttggtcatgttattacctcacggttct
gaaggacagggtgcagagcactcgtctgcaagattagagcgtttccttacactttgtgca
aaccagaatattattgtagcgaatgctactacaccagctaactacttccacctgttgaga
agacaaatgaagtctaacttcagaaagccgttagtcgtaatgacgcctaaatctttatta
cgtcatccaaaagctgtttctaaagttgaagaactggcaaacggaacattccagccggta
attgacgatgcaactgctaaagcagataaagtagaaagactggtaatgtgttccggtaaa
ctatactacgagcttttagctaaaaaagaagagttaaacgatgagaaagtagccttggta
agacttgagcaattatatccgcttcaaatggatcagattgatgcgatcttccaaaaatat
gcaaacgctaaagaatttatctgggctcaggaagaaccagaaaatatgggtgcatggagc
tatattcttagaagcttcagagagagaaatccacaggtcatttctccggtagcaagtggt
gcaccggctcctggatctcacaagaagttcgagattaaccagaatgcaattatcaaccag
gtgtttcaatgcgaaggaacaccgtcaaaaagaccagtaacagcttaa

DBGET integrated database retrieval system