KEGG   Elizabethkingia anophelis FMS-007: M876_05875Help
Entry
M876_05875        CDS       T03946                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
emn  Elizabethkingia anophelis FMS-007
Brite
Enzymes [BR:emn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M876_05875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKH94090
LinkDB All DBs
Position
1237515..1238195
Genome map
AA seq 226 aa AA seqDB search
MKLFGAATLGFVLVAQLVSAQFKQAPLPYAYNALEGSIDAQTMEIHYSKHGAAYVANLNK
AITGTSLEKESLVKILSGISKQSPAIRNNAGGHYNHELFWTILTPEKNTQPSEKLAKAIN
QSFGSFDAFKEKMSKAGADRFGSGWAWLIVTPEKKLAITSTANQDNPLMDIAEVKGIPVL
GIDVWEHAYYLKYQNKRADYLSAIWNVINWKEINKRYEAALNGKTE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatttggagcagccacactaggatttgtacttgtggcacagctggtatcagca
caattcaagcaagcaccattaccttatgcttataatgcactggaaggatcaattgatgca
caaacaatggaaatacattacagtaagcacggtgcggcatatgtagcaaacctaaataag
gctattacgggaacatctttggaaaaagaaagtcttgtgaaaatactttccggaatctca
aaacagagcccggcgataagaaacaatgccggtggccattataaccatgagctattctgg
acaatccttactcctgaaaagaatactcaaccatcggagaaactagcaaaagctattaat
cagtcttttggtagtttcgatgcctttaaagaaaaaatgagtaaagccggagcagatcgt
tttggttccggttgggcatggcttattgttaccccggagaaaaaattagcaattacttct
actgcaaatcaggataacccattaatggatattgctgaggtgaaaggtatacctgtttta
ggaattgatgtttgggaacatgcctattacctgaagtaccagaataaaagagctgattac
ctcagcgctatctggaatgtaatcaactggaaagagattaataagcgatatgaagctgcc
ctaaacggaaaaactgaataa

DBGET integrated database retrieval system