KEGG   Elizabethkingia anophelis FMS-007: M876_07095Help
Entry
M876_07095        CDS       T03946                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
emn  Elizabethkingia anophelis FMS-007
Pathway
emn00010  Glycolysis / Gluconeogenesis
emn00020  Citrate cycle (TCA cycle)
emn00620  Pyruvate metabolism
emn01100  Metabolic pathways
emn01110  Biosynthesis of secondary metabolites
emn01120  Microbial metabolism in diverse environments
emn01130  Biosynthesis of antibiotics
emn01200  Carbon metabolism
Module
emn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:emn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M876_07095
   00020 Citrate cycle (TCA cycle)
    M876_07095
   00620 Pyruvate metabolism
    M876_07095
Enzymes [BR:emn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M876_07095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C
Motif
Other DBs
NCBI-ProteinID: AKH94329
LinkDB All DBs
Position
1512344..1513930
Genome map
AA seq 528 aa AA seqDB search
MAEVITMPRLSDTMTEGKVSKWHKNVGDTVKEGDLLAEIETDKAVQDFESEINGTLLYQG
VAEGGQAPVDTVLCIIGKEGEDISVLIGGAPAKEEAPAQPVAEPAATESTASAEVPAGVE
IITMPRLSDTMTEGKVAKWHKNVGDAVKEGDILAEIETDKAVQDFESEFNGTLLYQGVAE
SGAALVDTVLAIIGPAGTDVSGLTSGKPAAKSDAAPAASEKPVATQPKEEVVATSSTGDR
VAISPLARKIASDKGIDISTVKGSGDGGRIVKKDIENYQPSAQAATSTATVAPAKAVVNF
VAGEDTETPNSQVRNVIAKRLSESKFTAPHYYLMVEINMDKAIAARKEINSLPDTKVSFN
DMIIKATAIALRKHPQVNSSWAGDKIIHRGNINIGVAVAIPDGLVVPVLKNTDHMSYSEI
SASVKDMAARAKNKGLKANEMEGSTFSISNLGMFGIETFTSIINQPNAAILSVGAIIEKP
VVKDGQIVVGNTMKLSLACDHRVVDGATGAQFLQTLRTYLENPLSLLV
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaatcacaatgccgcgcctttcggatactatgacggagggtaaggtttca
aaatggcataaaaatgtaggtgatacggttaaagaaggagaccttcttgctgaaatcgaa
actgataaagcggtacaggactttgaatctgaaatcaacggaacattactttatcagggt
gttgctgaaggtggtcaagctcctgtagatactgttttatgtattattggtaaagaaggc
gaagatatttcagtattaataggtggtgcacctgcgaaagaagaagctcctgcacagcca
gtagcagaacctgcagcaactgaatctactgcttcagcagaagtaccagctggtgtagaa
attatcacaatgcctcgtctttctgatacaatgacagaaggaaaagttgctaaatggcac
aaaaatgttggtgatgcagtaaaagaaggagacatcttagcagaaattgaaactgataaa
gcggtacaggatttcgaatctgaattcaacggaacattactttatcaaggagtagctgaa
tctggtgcagcattggttgacaccgttttagcaattattggtcctgcagggacagatgtt
tcaggattaacttcaggaaaacctgcagctaaatctgatgcagcgccggcagcatctgaa
aagccagttgcaactcaaccaaaagaagaagttgtagcgacttcatctacaggtgacaga
gtagcaatttctccattagcacgtaaaattgcttcagataaaggaatcgacatctcaact
gtaaaaggctcaggtgatggtggtagaatcgtgaagaaagatattgaaaactatcagcct
tctgcacaggctgctacatcaactgcaacagtggctccggctaaggctgtagtgaacttt
gtagctggtgaagatactgaaactccaaactctcaggttcgtaacgtgatcgcgaaaaga
ctttctgaaagtaaattcacggcacctcactactacctgatggtggaaatcaatatggat
aaagctattgcagcaagaaaagaaatcaacagcttgccagatactaaggtatctttcaac
gacatgattattaaggctactgcaattgctttaagaaaacatccacaagtaaacagctca
tgggcaggtgataaaatcatccaccgtggaaatatcaatattggtgtagctgtagcgatt
ccggacggattggtagttcctgtattaaagaatacagaccatatgtcttactctgaaatt
tcggcttcagtaaaagatatggctgcaagagctaaaaacaaaggtcttaaagctaacgaa
atggaaggaagtacattctctatttctaaccttggaatgttcggtatcgaaacatttaca
agtattatcaaccagccaaatgctgctattctttcagtaggtgctatcatcgagaagcct
gttgttaaagatggtcagattgtagttggtaatacgatgaagctttcattagcttgcgac
cacagagtggttgatggtgctacaggggctcagttcttacaaacattaagaacttacctt
gagaatccattaagcttattggtataa

DBGET integrated database retrieval system