KEGG   Elizabethkingia anophelis FMS-007: M876_09555Help
Entry
M876_09555        CDS       T03946                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
emn  Elizabethkingia anophelis FMS-007
Pathway
emn00564  Glycerophospholipid metabolism
emn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:emn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    M876_09555
Enzymes [BR:emn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     M876_09555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like GIDA Pyr_redox_3 NAD_binding_8 FAD_binding_3 Pyr_redox_2 Thi4 GMC_oxred_N
Motif
Other DBs
NCBI-ProteinID: AKH94808
LinkDB All DBs
Position
2030123..2031724
Genome map
AA seq 533 aa AA seqDB search
MKRKEELIKVSQNQEWDFIIIGGGASGLGSALDATTRGFRTLLLESHDFAKATSSRSTKL
VHGGVRYLAQGNIDLVKEALYERGLLAKNAAHLVKNQSFIIPNYNWWGGIYYKIGLSVYD
FLAGKLSLGKTRYINKAQTVEKLPTIEQKGLASGVVYQDGQFDDSRLAINLAQTIVEKGG
TVINYTKVVGLLKNESNKITGVIAEDQFTKERYEIKAKAVVNATGVFTNEILNMSNPKHG
KFVVPSQGIHFVLDKSFLKSNDAIMIPKTSDGRVLFVVPWHERALIGTTDTLVDEPSFEP
KALDSEIDFVLKTARQYLSKKPTKEDVLSVFAGLRPLAAPKDGSKSTKEVSRSHKVIVAE
TGLVTITGGKWTTYRQMAEDTIDKAIEVHQLKNVASKTKDLSIHGNIPAKDVDRSNHLYI
YGSDIPAIKALQQEKPEYAERIHPNNEFTVAEVIWAIRNEMAETIEDVLARRVRLLFLDA
RAAIDSARKIAEIFAQELGWDAAKVENETESFISLAKEYLLIPYTPNEMKNTN
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaaagaagagcttataaaagtttcacaaaatcaggaatgggactttataatt
atcggaggtggtgccagcggattaggatctgctttggatgctacaacgagaggtttcagg
actttattactggaatcccatgattttgccaaagctacttcgagccggagtaccaaactt
gtgcatggtggtgtaagatacctggcacagggaaacatagatcttgttaaggaagccctg
tacgaaagaggacttctggcgaaaaatgctgctcatcttgtcaaaaaccagtcttttatt
attcctaattataactggtggggcggtatttattataaaataggactatctgtttacgat
tttctggctgggaaactcagccttggtaaaaccagatatatcaataaagcacaaaccgtt
gaaaagcttccgactatagagcagaaaggtcttgccagcggggttgtatatcaggatgga
cagtttgatgattcccgtctggccattaacctcgcccagactatagtagaaaaaggcggt
accgtaatcaattatacaaaggttgtaggtcttctgaaaaacgaaagtaataaaatcaca
ggagtaatagctgaagatcagtttactaaagaacgttacgaaataaaagcgaaagctgta
gttaatgcaacaggagttttcaccaatgaaatcctgaacatgagcaatccaaaacacgga
aaatttgttgttccaagtcagggaattcatttcgtattagataaatctttcttaaagagc
aatgatgctattatgatccctaaaacatctgacgggcgtgtccttttcgttgttccatgg
catgaaagagccttaataggtactactgataccttagtagatgaaccaagtttcgaaccg
aaagctctggattccgaaattgatttcgttttgaaaactgcacggcaatatctgtctaaa
aagccaactaaagaagatgtactttctgtatttgcaggcttacgtcctttagcagctccg
aaagacggaagcaaaagcacaaaagaggtatcccgaagtcataaagttattgtagccgaa
accggacttgtaaccattaccggcgggaaatggactacctaccgacaaatggctgaagat
actatagataaagcaatagaagttcaccaactgaaaaatgttgcttctaaaaccaaagat
ctttccatccacggaaatatcccggcaaaagacgtagacagaagcaatcatttatatatt
tatggttcggatattcctgctataaaagctctacagcaggaaaaaccggaatatgcagag
agaatacatccaaacaatgaatttaccgttgctgaagttatctgggctatccgaaacgaa
atggctgaaaccattgaggatgtactggccagaagagtccgtcttcttttcttagatgcc
agggcagccatagattcggcgcgaaaaatagcagaaatctttgctcaggaactgggttgg
gatgctgcaaaagtagaaaacgaaactgaaagtttcatttcactcgctaaagaatatctt
cttataccttatacacctaacgaaatgaaaaacactaattaa

DBGET integrated database retrieval system