KEGG   Elizabethkingia anophelis FMS-007: M876_17240Help
Entry
M876_17240        CDS       T03946                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
emn  Elizabethkingia anophelis FMS-007
Pathway
emn00240  Pyrimidine metabolism
emn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    M876_17240
Enzymes [BR:emn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     M876_17240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Imm72
Motif
Other DBs
NCBI-ProteinID: AKH96298
LinkDB All DBs
Position
complement(3702747..3703340)
Genome map
AA seq 197 aa AA seqDB search
MFLENTINHAKQSGWMEVICGSMFSGKTEELIRRLRRAEMAGQQVEIFKPKIDVRYSDED
IVSHNDNKIRSTAVDTPNEILLLGSNCDVVGIDEAQFFDESVVEVANQLANSGTRVVIAG
LDMDFMGRPFGPMPNLMATAEYVTKVHAICKRTGNLANYSLRTSASKDLVQLGETDSYEA
VSRRIFWEEMQKQDKNK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagaaaatacaattaaccacgccaagcaaagcgggtggatggaagtgatatgt
ggctcaatgttttccggtaaaacggaagagctaatcaggcgtctgcgcagagcagaaatg
gcaggtcagcaagtagaaatttttaaaccaaaaattgatgttcgttactccgatgaagat
atcgtttcgcacaacgataacaaaatccggagtacagctgtagatactcctaatgaaatt
ctgttactgggatccaattgtgatgtagtgggtattgatgaagcacaattttttgatgaa
agtgttgtagaagtagccaatcagttagccaatagtggaacaagagttgttattgccggg
ctggatatggactttatgggtcgcccttttggtcctatgcctaaccttatggcaacagct
gaatatgttacaaaagttcatgccatttgtaagagaacaggaaatttagccaattattca
ttaagaacatctgccagcaaagatttggttcagctaggagaaacagacagctatgaagct
gttagccgccgtatcttttgggaagagatgcaaaagcaagataaaaataaatga

DBGET integrated database retrieval system