KEGG   Ehrlichia muris: EMUR_00940Help
Entry
EMUR_00940        CDS       T02967                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
emr  Ehrlichia muris
Pathway
emr00020  Citrate cycle (TCA cycle)
emr00190  Oxidative phosphorylation
emr00650  Butanoate metabolism
emr01100  Metabolic pathways
emr01110  Biosynthesis of secondary metabolites
emr01120  Microbial metabolism in diverse environments
emr01130  Biosynthesis of antibiotics
emr01200  Carbon metabolism
Module
emr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
emr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
emr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:emr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EMUR_00940
   00650 Butanoate metabolism
    EMUR_00940
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EMUR_00940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AHC39021
UniProt: V9R867
LinkDB All DBs
Position
233512..233868
Genome map
AA seq 118 aa AA seqDB search
MVSHSVYHWLFQRITACILLPLSLWFLFKFLGVISLILKSFPECRLSISDVSSTDLIVLL
CFFIFAFYHAVLGMQVILEDYIHSVVLRASVFLVIKGIVVLTTLFLAFIILYNVFLKY
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggttagtcattcagtgtatcattggttgtttcaaagaattacagcttgtattttactt
cctttgtccctatggtttttatttaagtttcttggtgttatttctttaatacttaagtct
tttccagagtgtcgtttatctatttcagatgtaagtagtactgatcttattgttttactg
tgcttttttatatttgcattttatcacgcagtcttaggtatgcaggttatattagaagat
tatatacactctgttgtgttaagggcatctgtatttcttgttattaaggggattgtagtt
ttaactacattgtttttagcatttataattttatataacgtgtttttaaaatactaa

DBGET integrated database retrieval system