KEGG   Ehrlichia muris: EMUR_01380Help
Entry
EMUR_01380        CDS       T02967                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
emr  Ehrlichia muris
Pathway
emr00970  Aminoacyl-tRNA biosynthesis
emr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EMUR_01380 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:emr03029]
    EMUR_01380 (gatB)
Enzymes [BR:emr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     EMUR_01380 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     EMUR_01380 (gatB)
Mitochondrial biogenesis [BR:emr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    EMUR_01380 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey DUF5030 DUF1786 YqeY
Motif
Other DBs
NCBI-ProteinID: AHC39089
UniProt: V9R8C1
LinkDB All DBs
Position
355584..357032
Genome map
AA seq 482 aa AA seqDB search
MRIIKGNRYDWEVVIGLEVHAQVISNSKLFSSASAKTYDALPNTQVSLFDVAMPGMLPVL
NEYCIYQAVKTGIALSCQINKYSAFDRKNYFYPDLPSGYQITQFYYPIATQGKIVLEDHD
MKEIRIARIHLEQDAGKSIHESNKTYLDFNRVGIALMEIVSEPDLRSAEEVAEYLKKLRM
ILRFIETCDGDMEKGSLRCDANVSVKPVGSSELGVRSEIKNLNSIRYVMQAIEYEANKQV
NALENGEILTQNTLLFDVDLGQTRVIRTKEDAHDYRYFPDPDLFPLKIDDQYINHVKSSL
PELPMQKRDRYISDFNLSKYDAGILSSDKDVAIYFEKVVEKHDAKLAASWITGELFSRLN
KLGITINESSVKAEHLIQLLDLMVDNTISWKIAKQVFDMMFESGKSPALIVNEHGLRQLS
DTNVLFAVVEKVLKDNTSKVEEYKQGKEKLFGYFVGQVMKATQGKANPDIVNSIIKQQLE
NK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagaattatcaaaggaaatagatatgattgggaagtggtaataggactggaagttcat
gcacaagttatttccaattctaaattattttctagtgcttcagcaaaaacttatgatgct
ttgcctaatacacaagtatcgctttttgatgtagcaatgccaggtatgttacctgtgctt
aatgaatattgtatttatcaggcagtaaaaactggaattgctttatcatgtcagattaat
aagtattcagcttttgatagaaagaattatttttatcctgatctgccttctggttatcaa
ataacgcagttttattatcctatagcgacacaaggtaaaattgttttagaagatcatgat
atgaaggagattcgtattgctaggattcatcttgagcaagatgctgggaaaagtattcat
gaatctaataagacttatctagacttcaatagagtaggtattgcattaatggaaatagta
tcggaacctgatttaagatctgctgaagaagttgcagaatatctaaaaaagttacgtatg
atattgcgttttatagagacatgtgatggagatatggaaaaaggttctttgcgttgtgat
gcgaatgtttcagtaaaacctgttggaagtagtgaacttggggtaagatctgaaataaaa
aatcttaattccattcgttatgttatgcaagctatagagtatgaagcaaataaacaggtt
aatgcgttggagaatggagaaatactaactcagaatacgttgttatttgatgttgattta
ggacaaacaagagtgattaggactaaggaagatgcccatgattatcgatattttccggat
cctgatttgtttccattaaaaattgatgatcagtatataaatcatgtaaaatcatccttg
ccagagttacctatgcaaaaaagagatcgttatattagtgattttaatctcagtaaatat
gatgcaggtattttatcttctgataaggatgttgctatatatttcgaaaaggttgtagaa
aagcatgatgcaaaacttgcagcatcttggataacaggtgaactttttagtaggttgaat
aagcttgggattactattaatgaatcttcagtaaaagctgaacatttaatacaattgctt
gatctaatggttgacaatactatttcttggaagatagcaaaacaggtatttgatatgatg
tttgagtcaggtaaatcacctgcactgatagtcaatgaacatggattaagacaactaagt
gatacaaatgtgttgtttgcagttgtggagaaagttttaaaagataatacaagtaaggtt
gaagaatacaaacaaggcaaggaaaagctatttgggtattttgtaggtcaggtgatgaaa
gcaacacaaggtaaagcaaatcctgatatagtgaattctattatcaagcagcagttagaa
aataaatag

DBGET integrated database retrieval system