KEGG   Ehrlichia muris: EMUR_02160Help
Entry
EMUR_02160        CDS       T02967                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
emr  Ehrlichia muris
Pathway
emr00020  Citrate cycle (TCA cycle)
emr00270  Cysteine and methionine metabolism
emr00620  Pyruvate metabolism
emr00630  Glyoxylate and dicarboxylate metabolism
emr00680  Methane metabolism
emr01100  Metabolic pathways
emr01110  Biosynthesis of secondary metabolites
emr01120  Microbial metabolism in diverse environments
emr01200  Carbon metabolism
Module
emr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
emr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:emr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EMUR_02160
   00620 Pyruvate metabolism
    EMUR_02160
   00630 Glyoxylate and dicarboxylate metabolism
    EMUR_02160
  09102 Energy metabolism
   00680 Methane metabolism
    EMUR_02160
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EMUR_02160
Enzymes [BR:emr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     EMUR_02160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4
Motif
Other DBs
NCBI-ProteinID: AHC39205
UniProt: V9R5Z6
LinkDB All DBs
Position
546726..547667
Genome map
AA seq 313 aa AA seqDB search
MIKRKKIALIGAGNIGGMVAYLARLKNLGDVVLLDINDGVAKGKALDMAESSAIGGYNGE
ILGASSYADIEGADAIVVTAGIARKPGMSRDDLISTNVNVIKEVAENIAKYAPNAFVVVV
TNPLDVMVLAMYKYSNLPSNMVVGMAGILDAARFSYFVAKELNVSVDSVNSLVLGGHGDL
MLPLVKYSSVGGISIADLIKTNLITQGKVDEIIERTRKGGEEVVSLLKTGSAYYAPAESA
LLMIDSYLNDRRLILSCSVYLKGEYGIYDLFVGVPVIIGKNGVEKIIELQLTEEENNVFN
NSVMLIKKLVSNI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcgtaaaaaaattgctcttattggtgcaggtaatattggaggtatggtagca
tatttagctaggttaaaaaatttgggagatgtagttttattagatattaatgatggtgta
gctaaagggaaggcactcgatatggctgaatcttcagcaataggagggtataatggagaa
atattaggtgctagcagttatgctgatattgaaggtgctgatgcaattgttgttactgct
gggatagctagaaagcccggcatgagtcgtgatgatttaattagtactaatgttaatgtt
ataaaagaagtagcagaaaatattgctaaatatgctcctaatgcatttgttgttgtagtt
actaatccacttgatgtaatggttttagctatgtataagtattcaaatttgccaagtaat
atggttgttggtatggctgggatacttgatgcagcaaggttctcttattttgttgcaaaa
gaattgaatgtatcagtggatagtgtgaattctctagtattaggtggtcatggagatcta
atgcttcctttagtaaaatactcatcagttggtggaatatctatcgctgatttaataaaa
accaatttgattacacaaggtaaagttgatgaaattatagaaaggactagaaaaggtggt
gaagaagtagtcagtttgttaaaaacaggttcagcttattatgctcctgctgaatctgct
ttgttaatgattgattcttatttaaacgatagaaggttaatattatcttgttccgtttat
ttaaaaggggaatatggaatctatgatttatttgtgggtgtgcctgtaattattggcaaa
aatggcgtagaaaaaataatagagctgcaactgactgaagaggaaaataatgtgtttaat
aattctgttatgttaattaagaagctagtgagtaatatttaa

DBGET integrated database retrieval system