KEGG   Ehrlichia muris: EMUR_03615Help
Entry
EMUR_03615        CDS       T02967                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
emr  Ehrlichia muris
Pathway
emr00020  Citrate cycle (TCA cycle)
emr00190  Oxidative phosphorylation
emr00650  Butanoate metabolism
emr01100  Metabolic pathways
emr01110  Biosynthesis of secondary metabolites
emr01120  Microbial metabolism in diverse environments
emr01130  Biosynthesis of antibiotics
emr01200  Carbon metabolism
Module
emr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
emr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
emr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:emr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EMUR_03615
   00650 Butanoate metabolism
    EMUR_03615
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EMUR_03615
Enzymes [BR:emr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EMUR_03615
    1.3.5.4  fumarate reductase (quinol)
     EMUR_03615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 PPO1_DWL Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AHC39454
UniProt: V9R9J7
LinkDB All DBs
Position
complement(888681..890477)
Genome map
AA seq 598 aa AA seqDB search
MSSSAYDIIDHEYDVVIVGAGGAGLRATFGMTNVGLSVACISKVFPTRSHTVAAQGGISA
ALGNVSEDDWRWHMFDTVKGSDWLGDQDAIEYMCKNAAEAVIELERYGVPFSRTSDGKIY
QRPFGGMTTEFGKGKPAVRTCAASDKTGHAILHTLYQQSLKYNAKFFVEYFAIDLIMDEE
GQCKGVLAWSLCDGTLHRFRAHIVVLATGGYGRIYFSATSAHTCTGDGGGMVSRINLPLE
DMEFVQFHPTGIYGAGCLITEGCRGEGGYLLNSEGERFMERYAPKAKDLASRDVVSRAMT
LEIREGRGVGPKKDHVYLSISHLGEKVISERLPGISETARTFAGVDVVKEPIPVLPTVHY
NMGGIPTNYHGEVLTLTDGREQVVPGLFAIGEAACVSVHGANRLGSNSLLDLVVFGRAAA
IRAKELIKPGMLHVPVKKSLEEWIIDRFDALRFSKGSLRVSEIRSNMQNVMQNHAAVFRT
EEVLEEGKVKIKSVAESLSEIAVEDRSMIWNSDLVEALELTNMMPQAVVTMECAANRQES
RGAHAREDFPDRDDKNWMKHSLAWYNSTNCSVRIKYKDVAKTTLTDDVQYFPPQKRVY
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtctagttctgcatatgatattatagatcatgaatatgatgttgtaatagtaggggct
ggaggagcaggattaagagcaacttttggtatgactaatgttggattatcagttgcatgt
atatcgaaagtctttcctacacgaagtcatacagtagcagctcaaggtggtatcagtgct
gcattaggtaacgtttctgaagatgactggagatggcatatgtttgatacagtcaaaggt
tcagattggcttggtgatcaggatgctattgaatacatgtgtaaaaatgcagcagaagct
gtaatcgagcttgagcgttatggagttcctttttctcgtactagtgatggtaaaatatat
caacgtccttttggtggaatgactactgaatttggtaagggtaagccagcagtgcgtaca
tgcgctgcatctgataagacaggtcatgcaatacttcatacattgtatcaacagtcttta
aaatataatgctaaattttttgtagagtattttgctattgatttaataatggatgaagaa
ggtcagtgtaagggtgtattagcatggtccttatgtgatggtacattacaccggttccgt
gctcacatcgttgttcttgctacaggtggttacggtaggatatatttttctgctactagc
gcacatacttgtactggtgatgggggaggtatggtatcccgtattaatttaccattagaa
gatatggaatttgtacaatttcacccaactggaatatatggtgctggatgtttgataacg
gaaggttgtagaggagaaggtggatatttacttaattctgagggggaaagatttatggag
cgttatgctccaaaagctaaagatttagcgtctcgtgatgttgttagtagagcgatgact
ttagaaatcagagaaggtcgtggtgttggtccaaaaaaagatcatgtgtatttatctata
tctcatttaggtgaaaaggttattagtgaaagattaccaggtattagtgaaactgctcgt
acttttgctggagtggatgttgtaaaagagccaataccagttttgccaactgttcattat
aatatgggaggtatccctacaaattatcatggtgaagttttaactttaactgatggtagg
gaacaagtagtaccggggctatttgccataggagaagcagcttgtgtttctgtacatgga
gctaatcgtttaggatctaattcattgcttgatttagtagtttttggaagagcagcagca
attagagctaaagagttaattaaacctggtatgttacatgttccagttaagaagtcatta
gaagaatggataattgatagatttgatgcgttgagattttcaaaaggaagtttgcgtgta
tcagagatacgtagtaatatgcaaaatgtaatgcaaaatcatgcagctgttttccgtaca
gaggaagtacttgaagaaggcaaggtgaagattaaaagtgttgctgaatctctatctgaa
attgcagttgaggataggagtatgatatggaatagtgatttagttgaagccttagagcta
actaatatgatgccacaagcagttgtaacaatggaatgtgctgcgaatcgtcaagaaagt
agaggtgctcatgcacgtgaagattttcctgatcgtgatgataaaaactggatgaagcat
agcttggcgtggtataattctacaaattgttctgtgaggataaaatataaggatgttgct
aagacaactttaacagatgatgttcagtattttcctccgcaaaaaagggtatattaa

DBGET integrated database retrieval system