KEGG   Eubacterium maltosivorans: CPZ25_001340Help
Entry
CPZ25_001340      CDS       T05996                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase FabK
  KO
K02371  enoyl-[acyl-carrier protein] reductase II [EC:1.3.1.9]
Organism
emt  Eubacterium maltosivorans
Pathway
emt00061  Fatty acid biosynthesis
emt01100  Metabolic pathways
emt01212  Fatty acid metabolism
Module
emt_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:emt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CPZ25_001340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:emt01004]
    CPZ25_001340
Enzymes [BR:emt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     CPZ25_001340
Lipid biosynthesis proteins [BR:emt01004]
 Fatty acid synthase
  Component type
   CPZ25_001340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMO IMPDH ThiG FMN_dh His_biosynth DHO_dh DUF561 Glu_synthase Dus Lipase_bact_N
Motif
Other DBs
NCBI-ProteinID: QCT70006
UniProt: A0A4V1GLJ5
LinkDB All DBs
Position
262520..263476
Genome map
AA seq 318 aa AA seqDB search
MINQLLNIKYPIIQGAMANIATPEFAAVASNAGCLGIIASGSMTGEETRAAVRRCRELTD
KPFGVNVMLMNPCSDDIMAVLIEEKVAAVTTGAGNPGKYLDALKEAGVKVFPVVASVALA
KRLAQNGADAIIAEGTESGGHIGDITTMSLVPQVAAAVDVPVIAAGGIASGRQLNAALCL
GAEGVQIGTCLLLAEECPIHENYKKAVIKAKDRDTVVTGRSLNAPVRVLKNAMTTEYLKI
EREGIEREEMERLTLGSLRKAVVEGDVKNGSLMMGQVAAMCKEVKPFSQIIDTLLGEAAE
EKKVFEKRSQELIYDTEC
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
ttgatcaatcaactactaaatataaaatatcccattatccagggcgcaatggcgaatatc
gccaccccggaatttgcggcagtggcctcaaatgccggctgtcttggcatcatcgcgagc
ggttccatgacgggtgaggaaacgcgcgcggcagtccgccgctgccgtgagctgaccgac
aagccctttggcgtcaatgtcatgctgatgaacccctgttccgatgatatcatggcggtt
ttaatcgaggaaaaggttgcggcggtaaccaccggtgcaggcaatccgggcaaatatctg
gacgcgctgaaagaggctggtgttaaagtttttccagtggtggcaagtgttgcactggcc
aagcggctggcacagaacggagcggacgccatcattgctgaaggaaccgaatccggcgga
catatcggtgatattaccactatgtccctcgtcccgcaggtagccgcagcagtggatgtc
cctgtgatcgcagccggtggcatcgcttccggcagacagctgaacgctgccctctgcctg
ggcgcagagggggttcagattggaacctgcctgcttttggctgaggaatgcccgatccac
gaaaactataaaaaagcagtgatcaaggcaaaggaccgcgatacggttgtgactggcaga
agcctgaacgcaccggttcgtgttctgaaaaatgccatgaccacagagtacctgaaaatc
gagcgtgaagggattgagcgggaagaaatggagcgcctgacgctgggctccctgagaaaa
gcggtcgtggaaggcgatgtgaaaaacggctccctgatgatgggccaggttgcagccatg
tgtaaagaggttaagcccttttcacagatcatcgacacgcttttgggagaagcggcagag
gaaaagaaagtctttgagaaaagaagccaggaactgatctatgatacagagtgttaa

DBGET integrated database retrieval system