KEGG   Eubacterium maltosivorans: CPZ25_013500Help
Entry
CPZ25_013500      CDS       T05996                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
emt  Eubacterium maltosivorans
Pathway
emt00040  Pentose and glucuronate interconversions
emt00051  Fructose and mannose metabolism
emt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CPZ25_013500
   00051 Fructose and mannose metabolism
    CPZ25_013500
Enzymes [BR:emt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     CPZ25_013500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PALP AlaDh_PNT_C UDPG_MGDP_dh_N Methyltransf_25 2-Hacid_dh_C UPF0146 Pyr_redox_2 Methyltransf_24 Methyltransf_31 TrkA_N
Motif
Other DBs
NCBI-ProteinID: QCT72300
UniProt: A0A4P9C9M8
LinkDB All DBs
Position
complement(2855210..2856262)
Genome map
AA seq 350 aa AA seqDB search
MKAVRMYKPGDLRVEDVEKPEMMDDEAMVKVRAVGLCGSDIPRALVYGAHVSPITIGHEF
SGEIEAVGKNVKNFKPGDRVVVPPLIPCGKCEWCQKGIYSLCEDYDYYGSRRDGALAEYV
SVKESNLLKVPEGVSYEDAATLDPCANAYHGLMRGNFKEGDSVCVCGTGPIGLFAAQYAK
LCGASQVIAVDVWDEKLDIAKKVGADVVINSLNEDPVEAVKKATDGKGANLVIDFSGVPA
AQKQCILMASKMGRVVFLGISHKGLDLSEKEVDTIMRSQLSVIGSWNSFTKPYPGEDWTE
SLKMFGERGMTAKDIISHRLPLDDCPGIFDKIKEGGFFYNKVMFYPWGQE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtaagaatgtataagcctggggacttgagagttgaggatgtcgaaaaaccg
gaaatgatggacgacgaagcgatggtaaaggttcgcgctgttggtctttgcggttcagat
attccgagagctctggtctatggcgctcatgtttctccgatcaccatcggccatgaattt
tccggcgaaatcgaagcggttggaaaaaatgtgaaaaactttaagcccggggaccgggtt
gtggttccgccgctcattccatgcggaaaatgcgaatggtgccagaagggaatctattct
ttatgtgaggattatgattactatggctccagacgcgacggcgcccttgccgaatatgta
tccgtcaaggaatcgaacctgctcaaggttccggaaggcgtatcctatgaggacgccgcg
acccttgacccgtgcgcaaatgcctatcacggactcatgcgcggcaactttaaagaaggc
gacagcgtctgtgtctgcggcactggccccattggcttattcgccgcgcagtacgcaaag
ctctgcggcgcctctcaggtcattgctgttgacgtctgggatgaaaagctggacatcgcc
aaaaaagttggcgcagatgtggtgatcaactctttaaatgaagatcctgtggaggcggtt
aaaaaagccactgacggcaaaggtgcaaatctggtcattgatttctccggtgttcctgca
gcccagaaacagtgtattctcatggcctctaaaatgggccgggttgtcttcctcggaatt
tctcataaaggcttagacttaagcgaaaaagaagtggacaccatcatgagaagccagctg
agcgttatcggttcatggaactccttcacgaagccttatcccggtgaagactggacggaa
tccttaaaaatgttcggcgaacgcggaatgaccgccaaagatatcatcagccaccgcctg
cctctggacgactgcccgggtatcttcgataaaatcaaagagggcggcttcttctacaac
aaggtgatgttctatccctggggccaggaataa

DBGET integrated database retrieval system