KEGG   Enterococcus mundtii: EMQU_1181Help
Entry
EMQU_1181         CDS       T02931                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
emu  Enterococcus mundtii
Pathway
emu00010  Glycolysis / Gluconeogenesis
emu00020  Citrate cycle (TCA cycle)
emu00620  Pyruvate metabolism
emu01100  Metabolic pathways
emu01110  Biosynthesis of secondary metabolites
emu01120  Microbial metabolism in diverse environments
emu01130  Biosynthesis of antibiotics
emu01200  Carbon metabolism
Module
emu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:emu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EMQU_1181
   00020 Citrate cycle (TCA cycle)
    EMQU_1181
   00620 Pyruvate metabolism
    EMQU_1181
Enzymes [BR:emu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EMQU_1181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 GCV_H Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: BAO06738
UniProt: V5XNU4
LinkDB All DBs
Position
1239923..1241575
Genome map
AA seq 550 aa AA seqDB search
MAYQFKLPDIGEGIAEGEIVKWFVQPGDTINEDDTLLEVQNDKSVEEIPSPVTGTVKSIV
VPEGTVANVGDVLVEIDAPGHEGNEESGSEGVAATEQTPEAPAAEPTTESSSASAEASDG
GVFQFKLPDIGEGIAEGEIVKWFVKAGDTINEDDTLLEVQNDKSVEEIPSPVTGTVKTIV
VSEGTVANVGDVLVEIDAPGHNSAPASKPAAATSDAKVETSGSSSIPEAANPDKRVLAMP
SVRQFAREKDVDISQVSATGKGGRVTKEDIENFLSGGGAPAAASKPAESAAPTEASAEKP
AETKAAPAKAFKSNLGDLEERVALTPTRKAIAKAMVNSKQTAPHVTLHDEVEVTNLWDNR
KKFKEVAAANGTKLTFLPYVVKALTATVKKFPILNASIDDAKQEIVYKNYYNIGIATDTD
HGLYVPNVKDADRKGMFAIADEINEKAKLAHDGKLAADDMRNGTITISNIGSVGGGWFTP
VINYPEVAILGVGTIAQQPIVNAEGEIVVGRVMKLSLSFDHRIVDGATAQQAMNNIKRLL
ADPELLMMEG
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggcttaccaatttaaattacctgatatcggtgaaggtatcgcagaaggtgaaatcgtt
aaatggttcgttcaaccaggcgatacgatcaatgaagacgatacattattagaagtacaa
aatgacaaatcagtggaagaaattccatctccagtaacaggaacagtgaaaagcatcgtt
gttccagaaggtacagttgcaaatgttggtgacgtattagttgagatcgatgcaccagga
catgaaggaaacgaagaaagcggaagcgaaggcgtggcagctactgagcaaacacctgaa
gcacctgctgctgaaccaacaacagaaagttcatctgcatcagcagaagcttctgacggt
ggcgtattccaattcaaattacctgatatcggtgaaggtatcgcagaaggtgaaattgtt
aaatggtttgttaaagccggtgacacgatcaatgaagacgatacattattagaagtgcaa
aatgacaaatcagtggaagaaattccatctccagtaacagggactgtgaaaacaatcgtt
gtttctgaaggtacagttgcaaatgttggtgacgtattggttgagatcgacgcgccagga
cacaatagtgcacctgcaagcaaaccagcggcagcaacttctgatgcaaaagtggaaact
tcaggttcttcaagtatccctgaagcggcaaacccagataaacgcgtattagcaatgcca
tctgttcgtcaattcgctcgcgaaaaagacgtggatatcagtcaagtttctgcaactgga
aaaggcggacgtgtgacaaaagaagatatcgaaaacttcttatctggcggaggcgctcca
gcagctgcaagcaaacctgctgaatcagctgcaccaacagaagcatctgctgaaaaacca
gctgaaacaaaagctgctccagcaaaagcattcaaatcaaacttaggcgatctagaagaa
cgtgtggcattgacaccaacacgtaaagcaattgccaaagcaatggtcaacagcaaacaa
acagcacctcatgtcactttacatgatgaagttgaagtaacaaatctttgggataaccgt
aagaaattcaaagaagtggcagctgctaacggcacgaaattaacgttcttgccttacgtt
gtcaaagcgttgactgcaacagtcaaaaaattcccaatcttgaatgcgtcaatcgatgat
gcaaaacaagaaatcgtttataaaaactattacaatatcggtatcgcaacagatacagac
catggtttgtatgtgccaaacgtgaaagatgctgaccgtaaaggaatgtttgcgatcgca
gacgaaatcaacgagaaagcaaaacttgctcatgatggcaaactagcggcagacgatatg
cgtaacggaacgatcacgatcagtaacattggttcagttggtggcggctggttcacacca
gtaatcaactaccctgaagtagcaatcttaggtgtaggaacaattgcacaacaaccaatc
gtcaatgctgaaggtgaaatcgttgttggccgagtgatgaaattatcattgagtttcgat
caccgaatcgtcgatggtgcgacagcacaacaagcaatgaataacatcaaacgtttatta
gctgatccagagctattaatgatggaaggatga

DBGET integrated database retrieval system