KEGG   Ensifer mexicanus: FKV68_14260
Entry
FKV68_14260       CDS       T06706                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
emx  Ensifer mexicanus
Pathway
emx00473  D-Alanine metabolism
emx00550  Peptidoglycan biosynthesis
emx01100  Metabolic pathways
emx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:emx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FKV68_14260
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FKV68_14260
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    FKV68_14260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:emx01011]
    FKV68_14260
Enzymes [BR:emx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     FKV68_14260
Peptidoglycan biosynthesis and degradation proteins [BR:emx01011]
 Precursor biosynthesis
  Amino acid ligase
   FKV68_14260
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 GARS_A CPSase_L_D2 ATPgrasp_ST
Other DBs
NCBI-ProteinID: QLL63815
LinkDB
Position
complement(2947496..2948422)
AA seq 308 aa
MSGRHVAVLMGGFSSERPVSLSSGAACADALEAEGYRVTRVDVGRDVAAVLGDLRPDVAF
NALHGPFGEDGTIQGILEYLEIPYTHSGVLASALAMDKAQAKHVAKASGIPVAEALIMDR
RTFGNEHPMKPPYVVKPVREGSSFGVVIVKEDQSHPPQVITSSEWRYGDRVMVERYIAGR
ELTCGVMGDVALGVTEIIPQGHAFYDYDSKYVKGGSSHVIPAQISPNIYQKIQTLALKAH
QAIGCRGVSRSDFRFDDRGTGEGELIWLEINTQPGMTPTSLVPEMAQHAGLQFGEFLRWM
VEDASCLR
NT seq 927 nt   +upstreamnt  +downstreamnt
atgagcggcaggcatgttgctgtcctgatgggcggattttcctcggagaggccggtgagc
ctgtcttccggggctgcttgcgccgatgccctcgaggccgaaggctatcgcgtcacgcgc
gtggatgtcggccgcgatgtggctgccgttctcggcgatctccgcccggatgtcgctttc
aacgccctgcatggtccgttcggcgaagatggcacgatccagggcatcctggaatatctc
gagattccctacacgcattccggcgtgcttgcctcggcgctcgcgatggacaaggcgcag
gccaagcatgtcgccaaggcctccggcattccggttgcagaggcgctgatcatggatcgg
cggacattcggcaacgagcacccgatgaagccgccctacgtggtgaagccggttcgcgaa
ggctcgagcttcggcgtcgtgatcgtcaaggaggatcagtcgcatccgccgcaggtgatc
acgtcgagcgaatggcgctacggcgatcgtgtcatggtcgagcgctacatcgctggccgc
gagctgacctgcggtgtcatgggcgacgtcgcacttggcgtcaccgagatcattccgcag
gggcatgccttctacgattatgattcaaaatacgtaaaaggtggttcaagccacgtcatt
ccggcgcagatttcaccaaatatttaccaaaaaatacaaacactcgctttgaaggcgcat
caggcaatcggttgccgcggcgtcagccgatccgacttccgcttcgatgatcgcggtacc
ggcgaaggcgagttgatctggctggaaatcaacacccagcccggcatgaccccgacctcc
ctggtgcccgagatggcgcagcatgcgggccttcagtttggtgagtttctcaggtggatg
gtggaggacgcatcgtgtttgcgttga

DBGET integrated database retrieval system