KEGG   Escherichia coli NA114 (UPEC): ECNA114_0138Help
Entry
ECNA114_0138      CDS       T01998                                 

Gene name
mrcB
Definition
(GenBank) penicillin-binding protein 1b
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECNA114_0138 (mrcB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ena01003]
    ECNA114_0138 (mrcB)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ena01011]
    ECNA114_0138 (mrcB)
Enzymes [BR:ena01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     ECNA114_0138 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECNA114_0138 (mrcB)
Glycosyltransferases [BR:ena01003]
 Polysaccharide
  Bacterial polysaccharide
   ECNA114_0138 (mrcB)
Peptidoglycan biosynthesis and degradation proteins [BR:ena01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   ECNA114_0138 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly UB2H PBP1_TM Transpeptidase UvrB_inter DUF3484
Motif
Other DBs
NCBI-ProteinID: AEG34960
LinkDB All DBs
Structure
PDB: 

Position
154747..157272
Genome map
AA seq 841 aa AA seqDB search
MAGNDREPIGRKGKPTRPVKQKVSRRRYEDDDDYDDYDDYEDEEPMPRKGKGKGKGRKPR
GKRGWLWLLLKLAIVFAVLIAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMTIS
KNEMVKLLEATQYRQVSKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFDGDHL
ATIVNMENNRQFGFFRLDPRLITMISSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEH
DGISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDAR
YSKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIY
NPWRNPKLALERRNLVLRLLQQQQIIDQELYDMLSARPLGVQPRGGVISPQPAFMQLVRQ
ELQAKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVEGIPALKKQRKLSDLETAIVVVDRF
SGEVRAMVGGSEPQFAGYNRAMQARRSIGSLAKPATYLTALSQPKIYRLNTWIADAPIAL
RQPNGQVWSPQNDDRRYSESGRVMLVDALTRSMNVPTVNLGMALGLPAVTDTWIKLGVPK
DQLNPVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSFPQAER
AVPAQAAYLTLWTMQQVVQRGTGRQLGAKYPNLHLAGKTGTTNNNVDTWFAGIDGSTVTI
TWVGRDNNQPTKLYGASGAMSIYQRYLANQTPTPLNLVPPEDIADMGVDYDGNFVCSGGM
RVLPVWTSDPQSLCQQSEMQQQPSGNPFDQSSQPQQQQPAQQEQKDSDGVAGWIKEMFGS
N
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaatgaccgcgagccaattggacgcaaagggaaaccgacgcgtccggtcaaa
caaaaggtaagccgtcgtcgttacgaagatgacgatgattacgacgattatgatgactat
gaggatgaagaaccgatgccgcgcaaaggtaagggcaaaggcaaagggcgtaagcctcgt
ggcaaacgcggctggctatggctgctgctaaaactggctatcgtttttgccgtgctgatc
gccatttacggcgtttatctcgatcaaaaaattcgcagccgtattgatggcaaggtctgg
caattgcccgcggcagtttatggtcgaatggtcaaccttgagccagacatgaccatcagc
aagaacgagatggtgaagctgctggaggcgacccagtatcgccaggtgtcgaaaatgacc
cgtcctggtgagtttaccgtacaggccaacagcattgagatgatccgccgtccgtttgat
ttcccggacagcaaagaagggcaggtgcgcgcgcgtctgacctttgatggcgatcatctg
gcgacgatagtcaatatggagaacaaccgtcagttcggtttcttccgtcttgatccgcgc
ctgatcaccatgatctcttcgccaaacggtgagcagcgtctgtttgtgccgcgcagtggt
ttcccggatttgctggtggatactttgctggcgacagaagaccgtcatttctacgagcat
gatgggatcagtctctactcaatcggacgtgcggtgctggcaaacctgactgccggacgc
acggtgcagggggcgagtacgctgacgcaacagttggttaaaaacctgtttctctccagc
gagcgttcttactggcgtaaagcgaacgaagcctacatggcgctgatcatggacgcgcgt
tacagcaaagaccgtattcttgagctgtatatgaacgaggtgtatctcggtcagagcggc
gacaacgaaatccgcggcttcccgctggcgagcttgtattactttggtcgcccggtagaa
gaattgagcctcgatcagcaggcgctgttggtgggtatggtgaaaggggcgtccatctac
aacccgtggcgtaacccgaaactggcgctggagcgacgtaacctggtactacgtttgctg
caacagcaacaaattattgatcaagaactctatgacatgttgagtgcacgtccgctgggt
gttcagccgcgcggtggggtgatctctcctcagccagcctttatgcagctggtgcgtcag
gagctgcaggcgaaattaggcgataaggtaaaagatctctccggcgtgaagatcttcact
acctttgactcggtggcccaggacgcggcagaaaaagccgccgtggaaggcattccggca
ctgaagaaacagcgtaagttgagcgatcttgaaaccgcgattgtggttgttgaccgcttt
agcggtgaagttcgtgcgatggtcggtggctctgagccgcagtttgcgggctacaaccgt
gcgatgcaggcgcgtcgttcgattggttcccttgcaaaaccagcgacttatctaacggcc
ttaagccagccgaaaatctatcgtttgaatacgtggattgccgatgcgccaatcgcgctg
cgtcagccgaatggccaggtctggtcaccgcagaacgatgatcgtcgttatagcgaaagt
ggcagggtgatgctggtagatgcgttgacccgttcgatgaacgtgccaacggtgaatctg
ggcatggcgttggggctgcctgcggttacggatacctggatcaaactgggtgtgccgaaa
gatcaactgaatccagttccagcaatgttgttgggggcgttgaacttaacgccaatcgaa
gtggcgcaggccttccagactatcgccagcggtggtaatcgtgctccgctttccgcgcta
cgttcagtcatcgcagaagacggcaaggtgttgtatcagagcttcccgcaggcagaacgc
gctgttccggcgcaggcggcgtatctgacactatggaccatgcagcaggttgtacaacgc
ggtacgggacgtcagcttggggcaaaatacccgaacctgcatctggcagggaaaacaggg
actaccaacaataacgtagatacctggtttgcgggcattgatgggagcacggtgaccatc
acctgggtcggccgtgataacaaccagccgaccaaactgtatggtgccagcggggcaatg
tcgatttatcagcgttatctggctaaccagacgccaacaccgctgaatcttgttccgccg
gaagatattgcagatatgggcgtggactacgacggcaactttgtttgcagcggtggtatg
cgtgtcttgccagtctggaccagcgatccgcaatcgctgtgccagcagagtgagatgcag
cagcaaccgtcaggcaatccgtttgatcagtcttctcagccgcagcaacagcaacctgct
caacaggagcaaaaagacagcgacggcgtggctggctggatcaaggagatgtttggtagt
aattaa

DBGET integrated database retrieval system