KEGG   Escherichia coli NA114 (UPEC): ECNA114_0170Help
Entry
ECNA114_0170      CDS       T01998                                 

Gene name
fabZ
Definition
(GenBank) 3R-hydroxymyristoyl-acyl carrier protein dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00061  Fatty acid biosynthesis
ena00780  Biotin metabolism
ena01100  Metabolic pathways
ena01212  Fatty acid metabolism
Module
ena_M00083  Fatty acid biosynthesis, elongation
ena_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECNA114_0170 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ECNA114_0170 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ena01004]
    ECNA114_0170 (fabZ)
Enzymes [BR:ena01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ECNA114_0170 (fabZ)
Lipid biosynthesis proteins [BR:ena01004]
 Fatty acid synthase
  Component type
   ECNA114_0170 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AEG34992
LinkDB All DBs
Structure
PDB: 

Position
195211..195666
Genome map
AA seq 151 aa AA seqDB search
MTTNTHTLQIEEILELLPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
FPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactaacactcatactctgcagattgaagagattttagaacttctgccgcaccgt
ttcccgttcttactggtggatcgcgtgctggattttgaagaaggtcgttttctgcgcgca
gtaaaaaatgtctctgtcaatgagccattcttccagggccatttccctggaaaaccgatt
ttcccgggtgtgctgattctggaagcaatggcacaggcaacaggtattctggcgtttaaa
agcgtaggaaaactggaaccgggtgagctgtactacttcgccggtattgacgaagcgcgc
tttaagcgcccggtcgtgcctggcgatcaaatgatcatggaagtcactttcgaaaaaacg
cgccgcggcctgacccgttttaaaggggttgctctggtcgacggtaaagtagtttgcgaa
gcaacgatgatgtgtgctcgtagccgggaggcctga

DBGET integrated database retrieval system