KEGG   Escherichia coli NA114 (UPEC): ECNA114_1656
Entry
ECNA114_1656      CDS       T01998                                 

Definition
(GenBank) Two-component regulatory system rstB like sensory protein
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ena00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECNA114_1656
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ena01001]
    ECNA114_1656
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ena02022]
    ECNA114_1656
Enzymes [BR:ena01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ECNA114_1656
Protein kinases [BR:ena01001]
 Histidine kinases
  OmpR family
   ECNA114_1656
Two-component system [BR:ena02022]
 OmpR family
  RstB-RstA
   ECNA114_1656
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3
Other DBs
NCBI-ProteinID: AEG36482
LinkDB
Position
1663880..1665181
AA seq 433 aa
MKKLFIQFYLLLFVCFLVMSLLVGLVYKFTAERAGKQSLDDLMNSSLYLMRSELREIPPH
DWGKTLKEMDLNLSFDLRVEPLSKYHLDDISMHRLRGGEIVALDDQYTFLQRIPRSHYVL
AVGPVPYLYYLHQMRLLDIALIAFIAISLAFPVFIWMRPHWQDMLKLEAAAQRFGDGHLS
ERIHFDEGSSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSDNL
SAAESQALNRDISQLEALIEELLTYARLDRPQNELHLSEPDLPLWLSTHLADIQAVTPDK
TVRIKTLAQGHYAALDMRLMERVLDNLLNNALRYCHSTVETSLLLSGNRATLIVEDDGPG
IAPENREHIFEPFVRLDPSRDRSTGGCGLGLAIVHSIALAMGGTVNCDTSELGGARFSFS
WPLWHNIPQFTSA
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaaaaaactgtttatccagttttacctgttattgtttgtctgcttccttgtgatgtct
ctgctggtcgggctggtgtacaaatttaccgccgaacgcgcaggcaaacagtcgctggat
gatttgatgaacagttcgctgtatctgatgcgcagcgaattgcgtgagatccccccacac
gactggggtaagacgctgaaagagatggatttaaatctctctttcgatctgcgtgtcgag
ccgctgagtaaatatcatcttgatgatatttccatgcaccggctgcgtggcggcgaaatt
gtcgctctggacgatcagtacacttttttgcaacgtatcccacgcagccactacgtgctg
gcagttggtcctgttccttatctttattacctccatcagatgcgattgctggatatcgcc
ctgatcgcttttattgccatttccctcgcctttccggtgtttatctggatgcgtccgcac
tggcaggatatgttaaaactggaagcagcggcgcaacgatttggcgatgggcatctcagt
gagcgtatccactttgatgaaggttcgagctttgaacgacttggcgtcgcatttaaccag
atggcggacaatatcaacgccttgattgccagcaaaaaacagcttattgacggtatcgct
cacgaactgcgaacaccgttagtgcgcctgcgttatcgactggagatgagcgataacctg
agcgccgccgaatcccaggcgttgaatcgcgatatcagtcaacttgaagctttaattgaa
gagctgctgacttatgcccggctcgatcgcccacaaaatgagcttcatcttagcgaacca
gacctgccgttgtggctgtcaacgcatctggcagatattcaggcagtaacgcccgataaa
acggtacggataaaaacgctcgcgcaaggccattatgctgcgttggatatgcgcttaatg
gagcgcgtgctggataatttgctcaataacgccctgcgctactgtcactcaacggttgaa
accagcctgctactgtcggggaatagagcgacattaattgttgaggatgatggcccaggg
attgccccagaaaaccgcgaacatatctttgaaccttttgttcgcctcgatcccagccgg
gatcgctcaaccggcggctgcgggctggggctggccattgtccactctatagcactggca
atgggcggtacggttaattgtgacaccagcgaactggggggtgcccgcttctcgttcagc
tggccgttatggcataacatcccgcaatttacctctgcctga

DBGET integrated database retrieval system