KEGG   Escherichia coli NA114 (UPEC): ECNA114_2182
Entry
ECNA114_2182      CDS       T01998                                 

Gene name
gatD
Definition
(GenBank) Galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00052  Galactose metabolism
ena01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECNA114_2182 (gatD)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     ECNA114_2182 (gatD)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 3HCDH_N 2-Hacid_dh_C Shikimate_DH UDPG_MGDP_dh_N Methyltransf_25 PrmA ELFV_dehydrog FAD_binding_2 TrkA_N
Other DBs
NCBI-ProteinID: AEG37014
LinkDB
Structure
PDB: 
4UEJ 4A2C 4UEK 4UEO

Position
complement(2192198..2193238)
AA seq 346 aa
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRNNVFALPADMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSREMSAPQIQGVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtgaatgatactgatggtatcgtgcgcgtagcagaaagcgtcattcct
gaaattaaacatcaggatgaggtgcgggtaaaaattgccagctcgggcttatgtggttcc
gatttacccaggatatttaaaaatggtgcacattattatccaataacgttaggccatgaa
tttagtggctatattgatgcggtgggatccggtgttgatgatttacaccccggcgatgcg
gttgcctgtgtgccgttattaccctgttttacttgtccagagtgtctgaaagggttttat
tcccagtgcgcaaaatatgattttattggctcacggcgtgatggtggatttgccgaatat
attgtcgttaagcgaaacaatgtctttgcactacctgcggatatgcctattgaggatggc
gcttttattgaaccgattaccgttggcctgcatgcgttccatttagcgcaaggatgtgag
aataaaaacgttattattattggtgccggaaccattggcctgctggcaattcagtgcgct
gtcgcgctgggagcaaagagtgtgacggctatcgacattagctcagaaaaactggcactg
gcaaaatctttcggtgcgatgcaaacatttaacagccgtgaaatgagcgcgccgcaaata
cagggcgttttacgcgagctgcgctttaatcagcttatcctcgagacggctggcgtcccg
caaaccgtcgaactggcggtagagattgccggtcctcatgcccaactggcgctggtgggc
acgttgcatcaggatctgcatttaacatctgcaacgtttggcaaaatattgcgtaaagag
ctgacggttatcggcagttggatgaactactccagcccttggccggggcaggagtgggaa
acggcgagccggttgctgacagaacgtaagttaagcctggagccattaatcgctcaccgt
ggaagctttgaaagctttgcccaggcggtgcgtgacatcgctcgtaatgctatgccgggc
aaagtgttgctcattccctga

DBGET integrated database retrieval system