KEGG   Escherichia coli NA114 (UPEC): ECNA114_2780Help
Entry
ECNA114_2780      CDS       T01998                                 

Gene name
nlpD
Definition
(GenBank) Lipoprotein
  KO
K06194  lipoprotein NlpD
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    ECNA114_2780 (nlpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M23 LysM Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AEG37615
LinkDB All DBs
Position
complement(2837902..2839041)
Genome map
AA seq 379 aa AA seqDB search
MSAGSPKFTVRRIAALSLVSLWLAGCSDTSNPPAPVSSVNGNAPANTNSGMLITPPPKMG
TTSTAQQPQIQPVQQPQIQATQQPQIQPVQPVAQQPVQMENGRIVYNRQYGNIPKGSYSG
STYTVKKGDTLFYIAWITGNDFRDLAQRNNIQAPYALNVGQTLQVGNASGTPITGGNAIT
QADAAEQGVVIKPAQNSTVAVASQPTITYSESSGEQSANKMLPNNKPTATTVTVPVTVPT
ASTTEPTVSSTSTSTPISTWRWPTEGKVIETFGASEGGNKGIDIAGSKGQAIIATADGRV
VYAGNALRGYGNLIIIKHNDDYLSAYAHNDTMLVREQQEVKAGQKIATMGSTGTSSTRLH
FEIRYKGKSVNPLRYLPQR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgggaagcccaaaattcaccgttcgccgcattgcggcattgtcactggtttcg
ctatggctggcaggctgttctgacacttcaaatccaccggcaccggtcagctccgttaat
ggcaatgcgcccgcaaataccaattctggtatgttgattacgccgccgccgaaaatgggg
acgacgtctacagcgcagcaaccgcaaattcagccggtacagcagccacaaattcaggct
actcaacaaccgcaaatccagcctgtgcagccagtagctcagcagccggtacagatggaa
aacggacgaatcgtctacaaccgtcagtatgggaacattccgaaaggcagttatagcggc
agtacatacaccgtgaaaaaaggcgacacgcttttctatatcgcctggattactggcaac
gatttccgtgaccttgctcagcgcaacaatattcaggcaccatacgcgctgaacgtcggt
cagaccttacaggtgggtaatgcttccggtacgccaatcacaggcggaaatgccattacc
caggccgacgcagcagagcaaggagttgtgatcaagcctgcacaaaattccaccgttgct
gttgcgtcgcaaccgacaattacgtattctgagtcttcgggtgaacagagtgctaacaaa
atgttgccgaacaacaagccaactgcgaccacggtcacagtgcctgtaacggtaccaaca
gcaagcacaaccgagccgactgtcagcagtacatcaaccagtacgcctatctccacctgg
cgctggccgactgagggcaaagtgatcgaaacctttggcgcttctgaggggggcaacaag
gggattgatatcgcaggcagcaaaggacaggcaattatcgcgaccgcagatggccgcgtt
gtttatgccggtaacgcgctgcgcggctacggtaatctgattatcatcaaacataatgat
gattacctgagtgcctacgcccataacgacacaatgctggtccgggaacaacaagaagtg
aaggcggggcaaaaaatagcaaccatgggtagcaccggaaccagttcaacacgcttgcat
tttgaaattcgttacaaggggaaatccgtaaacccgctgcgttatttgccgcagcgataa

DBGET integrated database retrieval system