KEGG   Escherichia coli NA114 (UPEC): ECNA114_3664Help
Entry
ECNA114_3664      CDS       T01998                                 

Gene name
gadA
Definition
(GenBank) Glutamate decarboxylase alpha
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00250  Alanine, aspartate and glutamate metabolism
ena00410  beta-Alanine metabolism
ena00430  Taurine and hypotaurine metabolism
ena00650  Butanoate metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena02024  Quorum sensing
Module
ena_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ECNA114_3664 (gadA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECNA114_3664 (gadA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECNA114_3664 (gadA)
   00430 Taurine and hypotaurine metabolism
    ECNA114_3664 (gadA)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECNA114_3664 (gadA)
Enzymes [BR:ena01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ECNA114_3664 (gadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC PRTase_3
Motif
Other DBs
NCBI-ProteinID: AEG38504
LinkDB All DBs
Structure
PDB: 

Position
complement(3751211..3752692)
Genome map
AA seq 493 aa AA seqDB search
MDQKLLTDFRSELLDSRFGAKAISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL
ATFCQTWDDENVHKLMDLSINNLATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAID
LRCVNMVADLWHAPAPKNGQAVGTNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNL
VCGPVQICWHKFARYWDVELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNY
EFPQPLHDALDKFQADTGIDIDMHLPQELVFNVDYLGGQIGAPDIVWDFRLPRVKSISAS
GHKFGLAPLGCGWVIWRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLR
LGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLY
DLSERLRLRGWQVPAFTLGGEATDIVVMRIMCRRGFEMDFAELLLEDYKASLKYLSDHPK
LQGIAQQNSFKHT
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggaccagaagctgttaacggatttccgctcagaactactcgattcacgttttggtgca
aaggccatttctactatcgcggagtcaaaacgatttccgctgcacgaaatgcgcgatgat
gttgcatttcagattatcaatgatgaattatatcttgatggcaacgctcgtcagaacctg
gccactttctgccagacctgggacgacgaaaacgtccataaattgatggatttgtcgatc
aataacctggccactttctgccagacctgggacgacgaaaatgtccataagttgatggat
ttatccattaacaaaaactggatcgacaaagaagaatatccgcaatctgcagcaatcgac
ctgcgttgcgtaaacatggttgccgatctgtggcatgcgcctgcaccgaaaaatggtcag
gccgttggcaccaacaccattggctcttccgaggcctgtatgctcggcgggatggcgatg
aaatggcgttggcgcaagcgtatggaagccgcaggcaaacccacggataaaccaaacctg
gtgtgcggtccggtacaaatctgctggcataaattcgcccgctactgggatgtggagttg
cgtgagatccctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcc
tgcgacgaaaacaccatcggcgtggtgccgactttcggcgtgacctacaccggtaactat
gagttcccgcagccgctgcacgatgcgctggataaattccaggccgacaccggtatcgac
atcgacatgcacctgccgcaggaactggtgttcaacgttgactacctcggtggtcagatt
ggggccccggatatcgtctgggacttccgcctgccgcgtgtgaaatcgatcagtgcttca
ggccataaattcggtctggctccgctgggctgcggctgggttatctggcgtgatgaagaa
gcgctgccgcaggaactggtgttcaacgttgactacctcggcggtcagattggtactttc
gccatcaacttctcccgcccggcgggtcaggtgattgcacagtattatgaattcctgcgc
ctcggtcgtgaaggctataccaaagtacagaacgcttcctaccaggttgccgcttatctg
gcggatgaaatcgccaaactggggccgtatgagttcatctgtaccggtcgcccggacgaa
ggcatcccggcggtttgcttcaaactgaaagatggtgaagatccaggatacaccctgtac
gacctctctgaacgtctgcgtctgcgcggctggcaggttccggccttcactctcggcggt
gaagccaccgacatcgtggtgatgcgcattatgtgtcgtcgcggcttcgaaatggacttt
gctgaactgttgctggaagactacaaagcctccctgaaatatctcagcgaccacccgaaa
ctgcagggtattgcccagcagaacagctttaaacacacctga

DBGET integrated database retrieval system