KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_00322Help
Entry
ECL_00322         CDS       T01231                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECL_00322
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:enc02000]
    ECL_00322
Enzymes [BR:enc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ECL_00322
Transporters [BR:enc02000]
 Other Transporters
  Pores ion channels [TC:1]
   ECL_00322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 9122831
NCBI-ProteinID: YP_003610837
UniProt: A0A0H3CDI0
LinkDB All DBs
Position
331879..332550
Genome map
AA seq 223 aa AA seqDB search
MLTVHHLNQSRSHRVIWALEELSLPYEIVHYQREKTMLAPESLKRVHPLGKSPVIEDNGL
ILAESGAILEYLQETYDAESQLKPLDPAHKVQYRFWLHYAEGSLMPLLLMKLVFSSLGKP
PVPFGIRTLGKALGQGVQKAYLNPQLETHARFIESHLAENSWFAGETLSMADIQMSFPIF
ALLARGGVEDLPHTHAWKKKVENRPAWQRTLEQGGPLTIPGEA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctcacggtacatcaccttaaccagtcgcgctcacaccgcgtgatctgggctctggaa
gaactttctctgccctatgagattgttcactaccagcgcgaaaaaacgatgctggctccc
gagtcccttaaacgcgtgcatccgttgggcaagtctccggtcattgaagacaacggactg
atccttgctgaatccggtgccattctggagtatctgcaggaaacctacgacgcagaatcg
cagcttaagccgctggatcctgcccataaggtgcaataccgcttctggctacactatgca
gaaggttctcttatgccgctgctgttaatgaagctggtatttagcagcctcggtaaaccg
cccgtgccgtttggaatacgcacgctggggaaagcgctgggtcagggcgtgcaaaaggcc
tatctcaatccccagctcgaaacccacgcgcgttttattgaatctcacctggctgaaaat
agctggtttgccggagagactctcagcatggccgatattcagatgagtttcccgattttt
gccctgctggcacgcggcggtgtcgaggatcttccgcacacccatgcctggaagaaaaag
gtcgaaaatcgtcctgcctggcagagaaccctggaacaaggtgggccgttaacgatccct
ggcgaggcgtaa

DBGET integrated database retrieval system