KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01137Help
Entry
ECL_01137         CDS       T01231                                 

Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00473  D-Alanine metabolism
enc00550  Peptidoglycan biosynthesis
enc01100  Metabolic pathways
enc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ECL_01137
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECL_01137
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    ECL_01137
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:enc01011]
    ECL_01137
Enzymes [BR:enc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ECL_01137
Peptidoglycan biosynthesis and degradation proteins [BR:enc01011]
 Precursor biosynthesis
  Amino acid ligase
   ECL_01137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-GeneID: 9123641
NCBI-ProteinID: YP_003611647
UniProt: A0A0H3CJF6
LinkDB All DBs
Position
complement(1172615..1173715)
Genome map
AA seq 366 aa AA seqDB search
MAKQRVGIVFGGKSAEHEVSLQSAKNIVDAIDKNRFDVVLLGIDKQGQWHVNDASQYLLN
ANDPAHIALNPSEISVATVPGVVKGQLIDAGNAQALAQIDVVFPIVHGTLGEDGSLQGML
RMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNVAPFVTLTRANRDKYNFSQISAQLGL
PLFVKPANQGSSVGVSKVTSEAQFTEAVRLAFEFDHKVVVEQGIKGREIECAVLGNDFPQ
ASTCGEVVLNSDFYSYDTKYIDDKGAQVVVPANIDPAINDKIRAIAINAYQALGCCGMAR
VDVFLTPDNEVVINEINTLPGFTNISMYPKLWQASGLGYSELITRLIELALERHAADSAL
KSSVNG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcagcgcgtaggtattgtctttgggggaaaatcagcggagcacgaggtttca
ttgcagtcggcaaaaaatattgtcgatgcgattgataaaaaccgtttcgacgtagtgctg
ctgggcattgataaacagggccagtggcatgtgaacgatgcgagccagtatctgttaaac
gccaacgatccggcacatatcgcccttaatccttctgaaatcagcgtcgccaccgtccct
ggcgtagtgaaggggcaacttatcgacgccggtaacgcacaggctcttgctcagattgac
gtcgtgttcccaatcgtccacggcacgctgggcgaagatggttcgctgcagggtatgctg
cgcatggctaacctgccgtttgtcggctccgatgtgctgggctccgccgcctgtatggat
aaagacgtcaccaaacgcctgctgcgcgatgccgggctgaacgttgccccgttcgtgacg
ctcacccgcgccaaccgcgataaatacaacttcagccagatttccgcccagttgggtctg
ccgctgttcgtgaagcctgcgaaccagggctcctccgttggcgtcagcaaagtgacaagc
gaagcgcagttcaccgaagccgttcgtctggcttttgagtttgaccacaaagtcgtggtt
gagcagggtatcaaaggccgtgaaattgagtgcgcggtgctgggcaatgatttcccacag
gcaagcacctgcggtgaagtggtgttaaacagcgatttctactcttacgacaccaaatac
attgatgataaaggcgctcaggtcgtcgtgccggcaaatatcgatccggccatcaacgat
aagatccgggcgatcgccatcaacgcctatcaggctcttggctgctgcggcatggcgcgt
gtggatgtgttcctgacgccagataatgaggtggtgattaatgaaatcaacaccctgccg
ggctttaccaacatcagcatgtatccaaaactgtggcaggccagcggtctgggttactct
gagttgatcacccgtctgatcgaactggcgctggagcgtcatgccgctgacagcgcactc
aaaagttcagtaaacggttaa

DBGET integrated database retrieval system