KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01353Help
Entry
ECL_01353         CDS       T01231                                 

Definition
(RefSeq) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00500  Starch and sucrose metabolism
enc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECL_01353
Enzymes [BR:enc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ECL_01353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-GeneID: 9123857
NCBI-ProteinID: YP_003611863
UniProt: A0A0H3CG92
LinkDB All DBs
Position
complement(1371304..1372791)
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPAGGELWREVTALAPNLNEIGINMIWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKDSVATKYGDKAQLLEAIDALKSNNIAVLLDVVVNHKMGADEKEHVRVQRV
NEQDRTQIDDEIIECEAWTRYTFPARAGQYSQFVWDYKCFSGIDHIENPDEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTGCDGFRLDAVKHI
PAWFYKEWIEHVQEVATQPLFIVAEYWSHEVDKLQAYINQVEGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGASYDDTGGDGETYHIDMPVIEQLHELILARQRFAHGVQTLFFDHPNCI
AFSRSGTEEDPGCVVVMSNGDDGEKVICLGENYGNKTWRDFLGNREETVTTAADGEGTFT
CKGGSVSVWVIEDAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccaccctgttacaatgctttcactggtattaccctgcaggcggtgaattg
tggcgagaggtcacagcattagcccccaatcttaacgaaatcggcatcaatatgatctgg
ctgccgccagcctataaaggcgcatcgggcggttactcggtcgggtatgactcttacgat
ctgtttgatctcggcgagtttgaccagaaagacagtgttgccaccaaatacggtgataaa
gcccagcttctggaagccattgatgcgctcaaaagcaataacatcgcggtgctgctggat
gtggtggttaaccacaaaatgggcgccgatgagaaagagcacgttcgcgttcagcgtgtg
aacgaacaggaccgcacgcaaatcgatgatgagatcatcgagtgcgaagcctggacccgc
tacaccttccctgcccgcgccggacagtattcgcagttcgtctgggattacaaatgcttt
agcggcatcgaccacatcgaaaaccccgatgaggatggcatcttcaaaatcgtcaatgac
tacaccggcgaaggctggaacgatcaggtcgatgacgaaatgggtaatttcgactatctg
atgggcgaaaatatcgatttccgtaaccatgccgtgacggaggagatcaagtactgggcg
cgctgggtcatggaacaaaccggctgcgacggattccgcctggatgcggtcaaacacatc
cccgcctggttctataaggagtggattgaacacgttcaggaagtggcgacgcagccgctg
tttatcgtcgcggaatactggtcgcacgaggtggataagctgcaggcgtatattaatcag
gtcgagggtaaaacgatgctgtttgatgcccccctgcagatgaaattccacgaggcctcg
cgtcaggggcgggactacgacatgagccagattttcaccggcacgctggtggaggccgat
ccgttccatgcggtgacgctggttgccaaccatgacacccagccgttgcaggcgcttgaa
gccccggtggaagcctggtttaaaccgctggcttacgcgctgatcctgctgcgggaaaat
ggcgtgccgagcgtgttttatcccgatctctttggcgccagctatgacgataccggggga
gacggtgaaacttaccacattgatatgccggtgattgagcaactgcacgagctgatcctc
gcccgtcagcgctttgcccacggcgtgcagacgctgttttttgaccaccctaactgcatc
gcattcagccgcagtggcacggaagaggatcccggttgcgtggtggtgatgtccaatggg
gatgatggcgagaaggtaatctgccttggggaaaactacgggaacaaaacctggcgtgat
tttctcggcaatcgtgaagaaacggtcaccaccgcagcggatggcgaagggacatttacc
tgcaaaggcggaagcgtgagcgtgtgggtaattgaggatgcattgtag

DBGET integrated database retrieval system