KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_01481Help
Entry
ECL_01481         CDS       T01231                                 

Definition
(RefSeq) peptidoglycan synthetase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00550  Peptidoglycan biosynthesis
enc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECL_01481
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ECL_01481
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:enc01011]
    ECL_01481
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:enc03036]
    ECL_01481
Enzymes [BR:enc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECL_01481
Peptidoglycan biosynthesis and degradation proteins [BR:enc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ECL_01481
Chromosome and associated proteins [BR:enc03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    ECL_01481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-GeneID: 9123984
NCBI-ProteinID: YP_003611990
UniProt: A0A0H3CID8
LinkDB All DBs
Position
1498079..1499785
Genome map
AA seq 568 aa AA seqDB search
MIPSAGSFTPARFALLCFAIFCSLAFLLVRVAWLQIIKPDNLVKQEDMRSLREVAIDAPR
GMIMDREGRPLAVSVPVRAVWADPKTVLAKGGVGFDDRWQALASALHLSLSTLASRINSN
PQGRFIYLARQVDPAQAQWIDKLNLPGINLRDESRRFYPAGHVAANLIGFTNIDGQGIEG
VEKSFNAQLMGKAGVRQVREDRYGRVVENLTEVAPVPAHNIQLSIDERLQTITEDALDNA
VVWNKAESGASVLINIPTGEILAMASYPDFNPNNREGATLNDFRNRAISDTFEPGSTVKP
LVLMTALQQGLVQPDSVIDTHPYTLDGHRIRDVGYYPELTMTGILQKSSDTGVSRLSLAM
PIQHLIDTYRNFGFGTNTGLGLTGESSGLLPQRKFWSQLDRATFAFGYGLMVTPLQLAHV
YATIGGYGLERPLSITRIDPPVIGHRVMPEEIAHEVEHMMESVALPGGGGVKAAVRDYRV
AVKTGTAKKIDDSGKYVDKYVAYTAGVAPASDPRFALVVVINDPQNGAYYGGAVSAPVFS
EIMGNVLRLENVKPDGLPADSGHLIVMR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgataccgagtgccggcagtttcaccccggcacgttttgctctgctctgttttgctatt
ttttgcagcctggcatttttactggtacgcgttgcctggctgcagattattaaacctgac
aatttggtaaaacaggaagatatgcgatcgctgcgtgaggtggcgattgatgcaccgcgt
ggcatgatcatggaccgtgaaggtcgtccgctggcggtgagtgtgcccgtcagggccgtg
tgggccgaccccaaaacggtgctggcaaaaggtggggttgggtttgatgaccgctggcag
gcgctggccagtgcgctgcatctctcccttagcacgctggcatcgcgcattaacagtaat
ccgcagggacgcttcatttaccttgcccgtcaggtggatcctgctcaggcgcagtggatc
gataaactcaatttgccgggcatcaacctgcgcgatgagtcccggcgtttttatccggca
ggtcatgtggccgcaaaccttatcggttttaccaatattgatggtcaggggattgaaggc
gtagagaagagcttcaacgcgcagcttatggggaaggccggggtccggcaggtgagggag
gaccgctatggacgcgtggtggaaaacctgaccgaagtggcgcccgttcctgcgcataat
atccagttgagcattgacgagcggctgcaaaccatcaccgaggacgcgcttgataatgcg
gtggtctggaataaagccgagtcgggtgcatcggtcctgatcaatatccccacaggggaa
atactcgccatggcgagctatcccgatttcaacccgaacaatcgtgaaggtgcaacgtta
aacgattttcgtaatcgtgccattagcgataccttcgaacccggctccaccgttaagccg
ctggttctgatgacggcattgcagcaggggctggtgcaaccggacagcgtcattgatacc
catccgtatacccttgacggtcaccgtatccgtgatgtgggttactacccggaactgacg
atgaccgggatcctgcaaaaatcgagcgacaccggtgtttcccgtctctctctggcgatg
cccatccagcatcttatcgatacctaccggaactttggctttggcaccaataccgggctg
ggtttaacgggcgaaagctcagggttactgccgcagcgtaaattctggagtcaactcgac
agggcaacctttgccttcggctatggcctgatggtgacgccccttcagctggcccatgtc
tacgccaccattggcgggtatgggcttgagcgcccgctctcgatcacccgtatcgacccg
ccggtgataggccacagagtcatgccagaagagattgcccatgaagtggaacacatgatg
gaaagcgtggcgcttccgggcggtggaggagtgaaggccgccgtacgggattaccgggtg
gcggtcaaaaccggtacggcgaaaaagattgatgacagtggcaagtacgtcgataagtat
gtcgcctataccgcaggcgttgcgcctgccagcgacccgcgttttgcgctggtggtagtc
ataaacgatccgcagaacggtgcctattatggtggtgccgtttcagcgcccgttttcagt
gagatcatggggaatgtgctgcgccttgagaacgtgaaaccggatggcctgccggctgat
tccggccaccttatcgtcatgcgttaa

DBGET integrated database retrieval system