KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02231Help
Entry
ECL_02231         CDS       T01231                                 

Definition
(RefSeq) 4-aminobutyrate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00250  Alanine, aspartate and glutamate metabolism
enc00410  beta-Alanine metabolism
enc00640  Propanoate metabolism
enc00650  Butanoate metabolism
enc01100  Metabolic pathways
enc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECL_02231
   00650 Butanoate metabolism
    ECL_02231
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECL_02231
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECL_02231
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:enc01007]
    ECL_02231
Enzymes [BR:enc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECL_02231
Amino acid related enzymes [BR:enc01007]
 Aminotransferase (transaminase)
  Class III
   ECL_02231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 9124722
NCBI-ProteinID: YP_003612728
UniProt: A0A0H3CIQ5
LinkDB All DBs
Position
2282950..2284161
Genome map
AA seq 403 aa AA seqDB search
MCDFFARTAENATLTDVEGNDYIDFAAGIAVLNTGHRHPELVAAVEKQLHQFTHTAYQIV
PYESYVSLAEKLNELAPVQSPAKTAFFTTGAEAVENAIKIARAHTGRPGVIAFGGGFHGR
TYMTMALTGKVAPYKLGFGPFPGSVYHVPYPSELHGITTQDAITAIERLFKADIEAKQVA
AIIFEPIQGEGGFNVAPPDLVAAIRRICDEHGIVMIADEVQSGFARTGKLFAMEHYADKP
DLMTMAKSLAGGMPLSGVVGRAEIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDNESLC
ARARHLGDRLKATLEEIQGTFPALVAIRGRGSMIAAEFFDPESRAPSAAIAQAIQQKALA
QGLLLLICGQYGNVIRFLYPLTIPDAQFTQALAILQQVMRDKT
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgatttctttgcccgcacggcggagaatgccacgcttaccgacgtggaaggcaac
gactatattgatttcgccgccgggatcgcggtactgaataccggccatcgtcatcctgaa
ctggtggccgcagtggaaaaacagcttcaccagttcacccacacggcctaccagattgtg
ccgtatgaaagctacgtttcattagccgaaaaacttaacgagctggctccggtgcagagc
ccggccaaaacggcattcttcacaacgggcgcggaagcggtggaaaatgccattaaaatc
gcccgggcccacaccggcagaccgggcgtgattgccttcggaggaggctttcacggccga
acctatatgaccatggcattaaccggcaaggtcgcgccttataagctgggatttggcccc
ttcccggggtcggtttatcacgtgccctatccctcggagctgcacggcatcacgacgcag
gatgccatcacggcgatagaacgtctgttcaaagcagacattgaggcgaaacaggtagcg
gcgattatttttgaacccattcagggtgaaggcggattcaacgtcgccccgccagatctg
gtggccgccatccgccgtatctgtgatgaacacgggatcgtgatgattgccgacgaagta
cagagcggtttcgcccgtacggggaaactgtttgccatggaacactacgcggacaagccc
gacctgatgacgatggcgaaaagcctggcaggcggaatgccgctgtccggcgtggtgggt
cgcgccgaaatcatggacgcgccggcgcccggcggtctgggggggacctatgcaggcaac
ccgctggcggtggccgccgcgcacgcggtgctgaatattatcgacaacgagtcactgtgc
gcccgcgcccggcatctgggcgatcgactgaaagccaccctggaagagattcagggcacc
ttccctgcgctcgtggcgataaggggaagaggatcgatgattgcggcggagttttttgat
cccgagagccgtgcaccctcggccgccatcgcgcaggcgatccagcaaaaggcactcgcc
cagggcctgctgttattgatctgcggccagtacggcaacgtgatccgcttcctttatccg
ctgaccattccggatgcccagttcacccaggcgctggcgatcttgcaacaggttatgcgt
gataagacctaa

DBGET integrated database retrieval system