KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02498Help
Entry
ECL_02498         CDS       T01231                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00020  Citrate cycle (TCA cycle)
enc00480  Glutathione metabolism
enc01100  Metabolic pathways
enc01110  Biosynthesis of secondary metabolites
enc01120  Microbial metabolism in diverse environments
enc01130  Biosynthesis of antibiotics
enc01200  Carbon metabolism
enc01210  2-Oxocarboxylic acid metabolism
enc01230  Biosynthesis of amino acids
Module
enc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
enc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECL_02498
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECL_02498
Enzymes [BR:enc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ECL_02498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-GeneID: 9124984
NCBI-ProteinID: YP_003612990
UniProt: A0A0H3CL71
LinkDB All DBs
Position
complement(2545482..2546732)
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGKKITLQNGKINVPHNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEIYTGEKSTQVYGQDVWLPAETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSADAEKVIKFLR
EEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEGA
FKDWGYQLAQEEFGGELIDGGPWQKIKNPNTGKEIIIKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMEWFEAADLIVKGMEGAINAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcggaaggtaaaaagatcaccctgcaaaacggcaag
attaacgttcctcacaatccgatcattccattcatcgaaggtgatggtatcggtgtagac
gttaccccggcaatgctgaaagtggttgatgccgctgttgagaaagcctacaaaggcgag
cgtaaaatttcctggatggaaatttacaccggtgaaaaatctactcaagtttatggccag
gacgtttggctgccagcagaaacgctggacctgatccgcgactaccgcgttgctatcaaa
ggcccactgacgacgccagttggtggcggtatccgttccctgaacgtggcactgcgtcag
gagctggacctgtacgtgtgtctgcgtccggttcgttactatcagggcaccccaagcccg
gttaagcaccctgagctgaccgatatggttatcttccgcgaaaactcagaagacatctac
gcgggtatcgaatggaaagctgactctgctgacgcagaaaaagtgattaaattcctgcgc
gaagagatgggcgtgaagaaaattcgcttccctgagcattgcggtatcggcatcaagccg
tgctccgaagaagggaccaaacgtctggtgcgcgcagcaattgaatacgcgatcaccaac
gaccgtgactctgtgaccctggttcacaaaggcaacatcatgaagttcaccgaaggcgcg
ttcaaagactggggttaccagttggcgcaagaagagttcggcggtgagctgatcgacggc
ggcccatggcagaagatcaagaacccgaacaccgggaaagagatcatcattaaagatgtt
atcgccgatgcgttcctgcagcagatcctgctgcgtccagcggaatacgacgtgatcgcc
tgtatgaacctgaacggtgactacatctccgatgccctggctgcacaggttggcggtatc
ggtatcgccccaggcgcgaacatcggtgacgaatgcgccctgttcgaagcaacccacggt
actgcaccaaaatacgcaggccaggacaaagtgaacccaggctctatcatcctgtccgca
gagatgatgctgcgtcatatggaatggttcgaagccgcagacctgatcgtcaaaggtatg
gaaggcgcgattaacgcgaaaaccgtaacctatgacttcgaacgtctgatggaaggcgct
aagctgctgaaatgttcagagtttggtgacgcgattatcgcgaatatgtaa

DBGET integrated database retrieval system