KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_02505
Entry
ECL_02505         CDS       T01231                                 

Definition
(RefSeq) sensor protein PhoQ
  KO
K07637  two-component system, OmpR family, sensor histidine kinase PhoQ [EC:2.7.13.3]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc01503  Cationic antimicrobial peptide (CAMP) resistance
enc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:enc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECL_02505
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    ECL_02505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:enc01001]
    ECL_02505
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:enc02022]
    ECL_02505
   01504 Antimicrobial resistance genes [BR:enc01504]
    ECL_02505
Enzymes [BR:enc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ECL_02505
Protein kinases [BR:enc01001]
 Histidine kinases
  OmpR family
   ECL_02505
Two-component system [BR:enc02022]
 OmpR family
  PhoQ-PhoP (magnesium transport)
   ECL_02505
Antimicrobial resistance genes [BR:enc01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, protease PgtE [MD:M00744]
    ECL_02505
SSDB
Motif
Pfam: PhoQ_Sensor HATPase_c HATPase_c_5 HAMP HATPase_c_2 HisKA HATPase_c_3 OmpH DUF3450
Other DBs
NCBI-GeneID: 9124991
NCBI-ProteinID: YP_003612997
UniProt: A0A0H3CNB3
LinkDB
Position
2551992..2553443
AA seq 483 aa
MRHIMPLSLRVRFLLATAAVVLVLSLSYGMVALVGYSVSFDKTTFRLLRGESNLFYTLAK
WENNQISVEMPENLNQQSPTLALIYNEKGKLLWAQRDVPWLVKSIRPEWLKTNGFHEIEA
DLNTTSSLLREDRSLQKKLNEIRADDAETEMTHSVAINLYPATPDMPQLTIVVVDTIPVE
LKRSYRVWGWFVYVLAANLLLVIPLLWIAAWWSLRPIESLAKEVRELEEHHREKLNPETS
RELTSLVRNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVMQSTLRSMRSSRMSVDDAE
PVMLEQISRISQQIGYYLHRASMRSGSALLSRELHPVAPLLDNLTSALNKVYQRKGVNIS
LDISPEISFVGEKNDFMEVMGNLLDNACKYCLEFVEVSARQTDNELHIIVEDDGPGIPRN
KRDVVFDRGQRADTLRPGQGVGLSVAREIVDQYDGKIETGESLLGGARMEVIFGRQQPTS
NDS
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgcggcacattatgcccctttcactgcgggttcgctttttgctggccacagccgccgtt
gtgctggtgctgtcgctttcttacggcatggtggcgctggttggttacagcgtcagtttt
gataaaacgacctttcgtctgctgcgcggtgagagcaacctgttttataccctcgcaaag
tgggaaaacaaccagatcagcgtcgagatgccggagaatcttaaccagcagagtcccacg
ctggcgctgatttacaatgaaaaagggaaactgctgtgggcacagcgtgatgttccctgg
ctggtgaaaagcatccgcccggaatggctgaaaaccaacggatttcatgaaattgaagcc
gatctgaataccaccagcagcctgctgcgcgaagatcgctctctgcaaaaaaagctgaat
gagatccgcgccgatgacgccgaaacagaaatgacccactccgtcgccatcaacctctat
cccgccacgcctgacatgccgcagctgactatcgtagtggtggataccatccccgtcgag
cttaaacgctcttatcgggtctggggctggttcgtctacgtgctggctgccaatctgctg
ctggtcataccgctgctgtggattgctgcctggtggagtttgcgcccgattgaatcgctg
gcgaaagaggttcgcgagctggaggagcatcatcgcgagaagcttaatcctgagacatcg
cgtgagctaacaagtctggtgcgtaaccttaaccgcctgctgaaaagtgaacgcgagcgc
tacgataaataccgcaccacgttgactgacctcactcacagcctgaagaccccgctggcc
gtcatgcaaagcaccctgcgatccatgcgcagctccagaatgagcgtcgatgatgccgag
ccggtgatgctggagcagatcagccgtatttcgcagcaaattggctactatcttcatcgc
gccagcatgcgttccggcagcgccctgctgagccgggagctgcaccccgtggcaccactg
ctggataacctgacctctgcgctgaataaggtgtatcagcgtaaaggggtgaacatcagt
ctcgatatctctcctgaaatcagtttcgtcggcgaaaagaatgatttcatggaggtgatg
ggtaacctgctcgataacgcctgtaaatattgtctggagttcgtggaggtttccgcccgt
cagacggacaacgagctgcacatcattgttgaggacgatggcccggggatcccgcgaaac
aaacgtgacgtggtatttgatcgcggtcagcgtgcggatacattgcgtcccggccagggg
gtggggttgtccgtcgcacgcgagattgtcgaccagtacgacggcaaaatcgaaaccggt
gaaagtttacttggcggtgccagaatggaagtgatttttggccgtcagcagcccacatcg
aacgatagttag

DBGET integrated database retrieval system