KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03080Help
Entry
ECL_03080         CDS       T01231                                 

Definition
(RefSeq) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
KEGG Orthology (KO) [BR:enc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECL_03080
Enzymes [BR:enc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ECL_03080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 FAD_binding_3 Thi4 K_oxygenase AlaDh_PNT_C Glutaredoxin DAO FMO-like
Motif
Other DBs
NCBI-GeneID: 9125559
NCBI-ProteinID: YP_003613565
UniProt: A0A0H3CL68
LinkDB All DBs
Position
complement(3135848..3137413)
Genome map
AA seq 521 aa AA seqDB search
MLDTTMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEANDLAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFT
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFLNGQE
FGQGRMTLSEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNDYAVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSVIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIVLNAQTTEVKGD
GSKVTGLEYRDRVSGDVHSVPLSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactacaatgaaaacccagctcaaggcataccttgagaaactgaccaaacct
gttgagctgattgccacgctggacgacagcgctaaatcggcagaaatcaaggaactgctg
gcggagatcgccgaactgtcaccgaaagtgaccttcaaagaagcgaacgatctggcggtg
cgtaagccatctttcctgatcaccaacccgggctctgatcaggggccgcgttttgccggc
tcaccgctgggccacgaatttacctcactggtgctggctctgctgtggaccggtgggcat
ccgtcgaaagaggcgcaggcgctgctggagcagatccgcgatatcgacggggatttcacc
tttgaaacgtactattcactctcctgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgtcagtcctgaacccgcgtattaaacacaccgcaattgatggcggcactttccag
aacgaaatcaccgatcgcaacgtgatgggggttccggcagtgttcctgaatgggcaggag
tttggccagggccgtatgaccttgtccgaaattgtggccaaagtggataccggcgccgaa
aaacgtgccgcagaagagctgaacaagcgcgatgcgtatgatgtactgattgtcggctct
ggcccggcgggcgccgcggcagcggtctattccgcacgtaaaggtattcgtaccggtctg
atgggcgaacgctttggcggccaggtgctggataccgtggatatcgaaaactacatctct
gtgccgaagaccgaaggccagaaactggctggcgcacttaaagcgcacgtcaatgattac
gcagtggatgtgatcgacagccagagcgccagcaagctggttcctgccgcagtcgaaggt
ggcttacaccagattgaaactgcttccggcgcggtgctgaaagcccgcagtgttatcatt
gccaccggtgccaaatggcgaaacatgaacgtgccgggtgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgatggtccgctgtttaaaggcaaacgcgtggcggtg
attggcggcggtaactccggtgttgaagcggctatcgacctggcgggcattgttgaacac
gttaccctgctggaatttgcaccagagatgaaggcagaccaggtactgcaggataaagta
cgcagcctgaaaaacgtcgacatcgtgctgaatgcgcagaccacggaagtgaagggcgac
ggcagtaaagtcaccggtctggagtaccgcgaccgcgtcagtggcgatgtgcacagcgtt
ccgctttcggggatcttcgtgcagattggtctgctgccaaacaccacctggctggaaggc
gccattgagcgtaaccgcatgggcgagattatcatcgatgccaaatgtgaaaccagcgtg
aagggcgtatttgcggcgggcgactgtactaccgtgccgtacaagcagatcatcatcgcg
accggtgaaggggcgaaagcgtctctgagcgcgttcgactacctgattcgcaccaaaaca
gcataa

DBGET integrated database retrieval system