KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_03533Help
Entry
ECL_03533         CDS       T01231                                 

Gene name
glpA
Definition
(RefSeq) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00564  Glycerophospholipid metabolism
enc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECL_03533 (glpA)
Enzymes [BR:enc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECL_03533 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_oxidored Pyr_redox_2 DAO_C Thi4 NAD_binding_8 3HCDH_N HI0933_like FAD_binding_3 Pyr_redox_3 Pyr_redox Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 9126010
NCBI-ProteinID: YP_003614016
UniProt: A0A0H3CRB6
LinkDB All DBs
Position
3624756..3626384
Genome map
AA seq 542 aa AA seqDB search
MTIHDPRYSDVIIIGGGATGAGIARDCALRGLSVTLLERHDIATGATGRNHGLLHSGARY
AVTDGESARECIAENQILRRIARHCIEPTDGLFITLPEDDLAFQSTFITACQAAGIQAQA
IDPALARRIEPSVNPALTGAVKVPDGTVDPFRLTAANMLDAREHSARILTGHQVTGLIRE
GHRIVGVRVLDTQYNEHSELYAAVVVNAAGIWGQRIAEYADLSVRMFPAKGSLLILDHRI
NNHVINRCRKPSDADILVPGDTISLIGTTSTHVDYSEIDYNRVTAEEVDILLREGEKLAP
VMAQTRILRAYAGVRPLVASDNDPSGRNVSRGIVLLDHAARDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNSEPCVTAEQPLPGSRQSTEKTLQKIISLPAPLRGSAVYRHGDRTP
VWLGEGRLSRSLVCECEAVTAGEVQYAVENLTVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFHTTTATQSLDQLSDFLNERWKGIQPVAWGDALRESEFTRWVYQGLCGLEKEQRD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgacaattcacgatccacgctacagcgatgtgattatcattggcgggggcgcgaccggc
gctggcatcgcacgcgactgtgcgctcagagggctgagcgtcacgctcctggagcgccat
gatattgcgaccggcgctaccggacgcaatcatggcctgctgcacagcggcgcccgctac
gccgttaccgacggcgaatcggcacgcgaatgtatcgccgaaaatcagatcctgcgacgt
atcgcccgccactgtattgaaccgaccgacggcctgtttattacgcttcccgaagacgat
ctcgcctttcagtcaactttcattaccgcctgccaggccgcgggaattcaggcgcaagcc
attgacccagcccttgcacgccgcatcgaaccttcggttaatccggcactgacgggtgca
gtaaaagtcccggacggcaccgtagatccgtttcgtctgacggcggccaacatgctggac
gcccgcgagcacagcgcgcggatcctgaccggccatcaggtcaccgggcttatccgtgag
gggcatcgcatcgtgggcgtgcgggtcctggatacgcagtacaacgaacacagcgagctg
tatgccgctgtggtggtcaacgcggcggggatctgggggcaacgcatcgcagaatacgcc
gatttatctgtgcgcatgttcccggccaaaggctcgctgctgatccttgaccaccgcatt
aataaccatgtcatcaaccgctgccgtaaaccgtctgacgcagacatccttgtccccggc
gataccatttcgttaatcgggaccacctccacccacgttgactacagcgagattgactac
aatcgggtcaccgcagaagaggtcgacatcctgctgcgcgaaggagaaaaactggcgccg
gtgatggcccagacccgcatcctgcgcgcctacgcgggtgtgcgtccgcttgtcgccagc
gataacgacccgagcggacgcaatgtcagccgtggcattgtgctgcttgaccatgccgcg
cgcgacgggctggacggcttcatcaccatcaccggcggtaaattgatgacctaccgcctg
atggccgaatgggcgacggatgctgtctgccgcaaactgggcaatagcgaaccgtgcgtg
accgcagaacagcccctgcccggctcgcgccagtccaccgagaaaacgctgcaaaaaatt
atctccctgcctgccccgctgcgtggttcggctgtctatcgccatggcgacagaacaccg
gtctggctgggtgaaggacggctgagccgcagtctggtatgcgagtgcgaggccgttacc
gccggggaagtgcaatacgcggtggagaatctgacggtgaatagcctgctcgatctccgc
cgccgcacccgtgtcgggatgggcacctgtcagggggagctgtgtgcctgccgtgccgcc
gggctgctgcagcgttttcataccaccaccgccacccagtcgctcgatcagctcagcgat
tttctgaacgagcgctggaaaggcattcagcctgtcgcctggggcgatgccctgcgtgaa
agcgaatttacccgctgggtgtaccaggggctttgcggtcttgagaaggagcaacgcgat
gaaatttga

DBGET integrated database retrieval system