KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_04821Help
Entry
ECL_04821         CDS       T01231                                 

Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00250  Alanine, aspartate and glutamate metabolism
enc00410  beta-Alanine metabolism
enc00640  Propanoate metabolism
enc00650  Butanoate metabolism
enc01100  Metabolic pathways
enc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:enc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECL_04821
   00650 Butanoate metabolism
    ECL_04821
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECL_04821
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECL_04821
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:enc01007]
    ECL_04821
Enzymes [BR:enc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECL_04821
Amino acid related enzymes [BR:enc01007]
 Aminotransferase (transaminase)
  Class III
   ECL_04821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 9127291
NCBI-ProteinID: YP_003615297
UniProt: A0A0H3CSW4
LinkDB All DBs
Position
complement(4935327..4936592)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNDRRLQATPRGIGVMCNFYAEKAENATVWDVEGNEYIDFAAGIAVLNTGHRHPK
IISAIEKQLHAFTHTAYQIVPYEGYVSLAERINARVPIDGPAKTAFFSTGAEAVENAVKI
ARAYTRRPGLIAFGGAFHGRTSMTMALTGKVAPYKLGFGPFPGSVYHAQYPNELHGVSTA
EALKSLERIFKADIAPDQVAAIILEPVQGEGGFNIAPADFMQALRALCDTHGILLIADEV
QSGFARTGKLFSMEHHCVKPDLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEDDLCTRSAHLGHHLVEVLNKAKEHCPYIADIRAQGSMVAVEFND
PQSGLPSPEFTRQVQERALQEGLLLLSCGVYGNVIRFLYPLTIPEVQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgaactgaacgaccggcgtttacaggcgacgccgcgcggcatcggcgtg
atgtgtaacttctatgccgaaaaagctgaaaacgccacggtgtgggacgtcgagggcaac
gagtatatcgactttgccgccggaatagcggtgctgaacaccgggcatcgccatccaaaa
atcatttccgccattgaaaaacaacttcatgccttcacccacacggcgtaccagattgtg
ccgtacgaaggctatgtgtcgcttgccgagcgaatcaacgcgcgtgtgccgattgacggc
ccggccaaaaccgccttcttctcaacgggggcagaagccgtcgaaaacgcggtaaaaatt
gcccgcgcatacaccagacgccctggcctgatcgcctttggcggtgcttttcatggacgc
acctcgatgaccatggcgctgacggggaaagttgccccttacaagctgggtttcgggccg
tttcctggctcggtatatcacgcccaataccccaatgaactgcacggtgtcagtacggcg
gaggcattaaaaagcctggagcgtatcttcaaagcggacattgccccggaccaggtcgcg
gccattattcttgaaccggttcagggtgagggcggtttcaacattgcaccggcggatttt
atgcaggccttgcgcgccctgtgcgatacccacggtattttgctgatcgccgatgaggtg
caaagcggttttgcgcgtaccggaaaactgttctcgatggaacaccactgcgtgaagccg
gatctgatcaccatggcgaaaagcctggcgggtggcatgccgctctcggcggtgtcgggc
cgcgccgaggtgatggacgcgcctgcgcctggcggactgggcggtacctacgccggtaac
ccactggcgatcgccgccgcacatgccgtgctggacgtgattgatgaagacgatctttgc
acgcgctcggcgcacctgggtcatcatctggtggaagtactgaacaaagcgaaggaacat
tgtccatatatcgcggatatccgcgcacaaggctcaatggtggcggtggagtttaacgat
ccgcaatccgggctgccgtcaccggaattcacccgtcaggttcaggagcgagccctgcag
gaaggccttctgcttctgagttgcggcgtgtacggtaacgtcatccgtttcctctatccg
ctcacaatccctgaagtgcagttccgtaaagcgctggacattatttctgcgtcgctgact
cgttaa

DBGET integrated database retrieval system