KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_05032Help
Entry
ECL_05032         CDS       T01231                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Pathway
enc00620  Pyruvate metabolism
enc00680  Methane metabolism
enc01100  Metabolic pathways
enc01120  Microbial metabolism in diverse environments
enc01200  Carbon metabolism
Module
enc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:enc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECL_05032
  Energy metabolism
   00680 Methane metabolism
    ECL_05032
Enzymes [BR:enc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ECL_05032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 9127497
NCBI-ProteinID: YP_003615503
UniProt: A0A0H3CTI5
LinkDB All DBs
Position
5167440..5170091
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEASRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPNGEAASNPEVIARTLRKLKDQPNLNEA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNNCLKQLDNKDIADYERNQLMRRLRQ
LIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEANLGYRLPVDF
VPVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLKDIQVLISELSMVEATPELR
ALAGEEGASEPYRFLMKKLRSQLMATQAWLEARLKGQRLPKPEGLLSQNEQLWEPLYACY
KSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDVRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWEPSNETREVLNTCKAIVDAPKGSVAAYVISMAKTP
SDVLAVHLLLKEAGIDYALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKESWCRIMDEL
SDISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQNELETMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVKPELWALGKELRELLEGDIKVVLDIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRLAEEEGKDPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaagtgcttgga
gataccatcaaagatgcgttgggggaaaacatcctcgaccgcgttgaaaccatccgcaag
ctgtctaaatcttcccgtgccggtaacgaagcgagtcgtcaggagctgctcactaccttg
cagaacctctctaacgatgagctgctgcccgttgcacgcgcattcagccagttcctgaac
ctggcaaacacggctgagcaataccatagcatttcgccaaacggcgaagctgccagcaac
ccggaagtcattgcccgtacgcttcgtaaactcaaagaccagccaaacctcaacgaagcc
accattaaaaaagcggtggagtccctttcgctggagctggtgctgaccgcccacccaacc
gaaatcacccgtcgtaccctgatccacaaaatggttgaagtgaacaactgtctgaagcag
ttggataacaaagacattgccgactacgaacgtaaccagctgatgcgccgtctgcgccag
ctgattgcgcagtcctggcacaccgatgaaattcgtaagcatcgcccaagcccggtagac
gaggccaaatggggctttgcggtggtggaaaacagcctgtgggaaggggtgccgaactac
ctgcgtgagctgaacgaacagctggaagcaaacctgggctaccgcctgccagtagatttt
gtcccggtacgctttacctcctggatgggcggtgaccgcgacggtaacccgaacgtgacg
gcggaaatcacccgccacgtgctgctgctgagccgctggaaagccaccgatctgttcctg
aaagacattcaggtgctgatctccgagctgtcgatggtggaagcaacgccagaactgcgc
gcgctggccggtgaagaaggtgccagcgagccgtatcgtttcctgatgaaaaaactgcgt
agccagctgatggcgacccaggcctggctggaagcacgcctgaaaggccagcgcctgccg
aagccggaaggtctgctgagccagaacgaacagctctgggaaccgctatacgcctgctat
aaatcactacaggcctgcgggatgggcatcatcgccaatggcgaactgctcgacaccctg
cgccgcgtgaagtgttttggcgtgccgctggtgcgtatcgacgtgcgtcaggagagcacc
cgccataccgaagcgctgggcgaactgacccgttatcttggcattggcgactacgaaagc
tggtctgaagccgacaaacaggccttcctgatccgcgagctgaactccaagcgtcctctg
ctgccgcgcaactgggagccaagcaacgaaacccgcgaagtgctcaacacctgtaaagcg
atcgtggatgcgccaaaaggatcggtcgccgcctatgtaatctcgatggcgaaaaccccg
tccgacgtgctggccgttcacctgctgctgaaagaagccggtatcgactatgccctgccg
gtcgccccgctgtttgaaaccctcgacgacctgaacaacgccaatgatgtaatgacccag
ctgctgaacatcgactggtatcgcggctttattcagggcaaacagatggtgatgatcggc
tattccgactccgcaaaagatgcgggcgtgatggcggcatcctgggcgcagtatcaggcg
caggacgcgctgatcaaaacctgcgagaaagccggtattgagctgacgctattccacggt
cgcggtggttccattggccgtggcggtgcgcctgcgcacgcggcgctgctctctcagccg
ccaggaagcctgaaaggcgggctgcgcgtgaccgaacagggcgagatgatccgcttcaaa
tacggcctgccggaagtgaccatcagcagcctgtcgctctataccagtgcgattctcgaa
gcaaacctgctgccaccgccggagccgaaagaatcctggtgccgcattatggatgagctg
tctgacatctcatgcgacctgtaccgcggctacgtgcgtgaaaacaaagacttcgtacct
tacttccgctctgctacgccagagcaggagctgggcaaactgccgctgggttcacgtccg
gccaagcgtcgtccgaccggcggcgtggagtctctgcgtgcaatcccgtggatcttcgcc
tggacgcagaaccgtctgatgctgccagcctggctgggtgccggtgcggcgctgcagaag
gtggttgaagatggcaaacagaacgaactggaaaccatgtgccgcgactggccattcttc
tctacccgtctgggtatgctggagatggtcttctcgaaagctgacctgtggctggcggaa
tactacgatcagcgcctggtgaaaccagagctgtgggcgctgggtaaagagctgcgcgaa
ctgctggaaggcgacatcaaagtggtgctggatatcgccaacgactcccatctgatggcc
gatctgccgtggattgccgagtctatccagctgcgtaacatctataccgacccactgaac
gtcctgcaggcggagctgctgcaccgttcgcgtctggcggaagaggaaggtaaagatccg
gatccacgcgttgaacaagcgctgatggtgacgattgcgggcgttgcagcgggtatgcgt
aacaccggctaa

DBGET integrated database retrieval system