KEGG   Enterobacter cloacae subsp. cloacae ATCC 13047: ECL_05067Help
Entry
ECL_05067         CDS       T01231                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
enc  Enterobacter cloacae subsp. cloacae ATCC 13047
Brite
Enzymes [BR:enc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECL_05067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4600
Motif
Other DBs
NCBI-GeneID: 9127532
NCBI-ProteinID: YP_003615538
UniProt: A0A0H3CTL5
LinkDB All DBs
Position
complement(5205794..5206414)
Genome map
AA seq 206 aa AA seqDB search
MSYTLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANAALESLPEFANLPVEELITK
LDQLPADKKTVLRNNAGGHANHSLFWKGLKTGTTLQGDLKAAIERDFGSVDNFKAEFEKA
AATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPILGLDVWEHAYYLKFQN
RRPDYIKAFWDVVNWDEAAARFAAKK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagttatacactgccatccctgccgtatgcctatgacgcactggaaccgcatttcgac
aagcagacgatggaaatccatcacactaaacaccaccagacctatgtgaacaacgcgaat
gctgcgctggaaagcctgccagagttcgctaacctgcctgttgaagagctgatcactaaa
ctggatcagctgccagcggacaagaaaaccgtactgcgtaacaacgcgggcggccacgct
aaccacagcctgttctggaaaggcctgaaaaccggtaccaccctgcagggcgacctgaaa
gcggctatcgagcgcgacttcggttctgttgataacttcaaagcggaattcgaaaaagcg
gctgcaacccgtttcggctccggctgggcgtggctggttctgaaaggtgacaaactggcg
gtcgtttctaccgcaaaccaggactccccgctgatgggtgaagcgatttctggcgcatct
ggtttcccaattctgggtctggacgtgtgggaacacgcttactacctgaagttccagaac
cgtcgcccggactacatcaaagccttctgggatgtggtgaactgggacgaagctgcagcg
cgtttcgccgcgaaaaaataa

DBGET integrated database retrieval system