KEGG   Enterobacter sp. ODB01: A4308_04110
Entry
A4308_04110       CDS       T06363                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
end  Enterobacter sp. ODB01
Pathway
end00052  Galactose metabolism
end01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:end00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A4308_04110
Enzymes [BR:end01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     A4308_04110
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C TrkA_N Methyltransf_31 UDPG_MGDP_dh_N MTS Methyltransf_25 PrmA ELFV_dehydrog Shikimate_DH 3HCDH_N ThiF
Other DBs
NCBI-ProteinID: AMZ76242
LinkDB
Position
865530..866573
AA seq 347 aa
MKSVVIHAEGSVRVEERPIPQIQDADEVLVRIVCSGLCGSDIPRIFAKGAHYYPIILGHE
FSGHVEACGADVKDLQAGDAVACIPLLPCFSCPECGQGYYSLCKQYQFVGSRSDGGNAEY
IVVKRANLFRLPAEMAIEDGAFIEPVTVGLHAFHLASGCKGKNVIIVGAGTIGLLAMQCA
LALGAKSVTAIDINDDKLALAKTLGATQVFNSRTLSTDDILNAQSDSRFDQLVLETAGTP
QTVSLAIDIAGPHAQVALVGTLHHDLNLSAATFGKILRKELTLLGSWMNYSAPWPGEEWE
TAVRLLTGKKLQLEPLIAHTGDSESFAQAVQALNGAPMQGKIMLRFA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggtaattcacgctgagggcagcgtgcgcgttgaagaacgtccgatccct
caaatacaggatgcggatgaagttctggtgcgcattgtttgctcagggttatgcggctca
gatatcccgcgtatttttgccaaaggggcacactattatcctatcatccttggccatgaa
tttagcggacacgtcgaagcctgtggtgcagatgtaaaggacctccaggcgggagatgct
gtggcctgcattccacttctgccctgtttttcctgcccagagtgtgggcaaggctactac
tcgctgtgtaagcagtaccagtttgtcggctcacgcagtgacggtggcaatgccgaatat
attgtcgtgaagcgcgcgaacttgttccgcctgccagcagagatggcaatcgaagacggg
gcatttatcgaacctgtcaccgtaggtttgcacgcgtttcatctggcttcaggctgcaaa
ggtaaaaatgtcattatcgtcggagcggggacgatcggtctgctggcgatgcagtgcgcg
ttggcgctcggggcaaagagcgtaactgcgattgatatcaacgacgataaactcgccctg
gcgaaaacactgggtgcgactcaagtattcaacagccgtaccttgagcaccgatgacatt
ctcaacgcgcagagtgacagtcgatttgatcaactggtgctggagaccgcaggaacacca
caaactgtctcgcttgccattgatattgctggccctcacgcacaagttgcgctggtcggt
acattgcatcatgacctgaatttatctgccgcaacctttggcaaaatattacgtaaggaa
ctgacgcttttgggtagctggatgaactactctgcaccgtggccaggggaagagtgggaa
acagcagtccgcctgctcaccgggaaaaaactgcaactggagccgctcattgctcatact
ggcgacagtgaaagcttcgctcaggccgtgcaggcactgaatggggcaccgatgcagggc
aaaattatgctgcgtttcgcctaa

DBGET integrated database retrieval system