KEGG   Enterobacter sp. ODB01: A4308_09940Help
Entry
A4308_09940       CDS       T06363                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
end  Enterobacter sp. ODB01
Brite
KEGG Orthology (KO) [BR:end00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A4308_09940
Enzymes [BR:end01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A4308_09940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 NAD_binding_8 FAD_oxidored HI0933_like FAD_binding_3 Thi4 DAO Glutaredoxin K_oxygenase FMO-like AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AMZ77310
LinkDB All DBs
Position
2088944..2090509
Genome map
AA seq 521 aa AA seqDB search
MLDANMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEDNTLAV
RKPSFLIANPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITERNVMGVPAVYLNGQE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRISGDVHSVQLSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgcgaatatgaaaacccagctcaaggcctaccttgagaaactgaccaaacct
gttgagctgattgccacgctggatgacagcgcgaaatcggcagagatcaaggaactgctg
gcagagatcgctgaactgtcaccgaaagtgaccttcaaagaagacaatacgcttgcagtc
cgtaagccttctttcctgatcgccaacccgggttctgatcaggggccgcgctttgccggc
tctccgctggggcatgaatttacctcactggtgctggcgctgctgtggaccggtgggcat
ccgtctaaagaagcgcaggccctgctggagcagatccgcgacatcgacggtgatttcgag
tttgaaacctattactcactctcctgtcacaactgcccggacgtggtgcaggcgctgaac
ctgatgtcggtgctgaacccgcgcattaaacacacggcgattgacggcggtacgttccag
aatgagatcaccgagcgtaacgtaatgggcgtgccggcggtctatctgaatggtcaggag
tttggtcagggccgcatgacgctgacggaaattgttgccaaagtggataccggcgcagaa
aaacgcgcagcagaagcgctgaacaaacgtgatgcctacgatgtgctgatcgtcggttcc
ggcccggcgggcgcggcagcggcggtttactccgcgcgtaaagggatccgtaccggtctg
atgggtgaacgctttggcggccaggtactggataccgtggacatcgaaaactacatttcc
gtgccgaaaaccgaaggccagaaactggctggcgcacttaaagcgcacgtcagcgactat
gacgtggatgtcatcgacagccagagcgccagcaagctggttcctgctgcggtcgaaggc
ggtttacaccagattgaaacggcatccggcgcggtgctgaaagcgcgtagcattatcatt
gccaccggcgcgaaatggcgcaacatgaacgttccgggtgaagatcagtaccgcaccaaa
ggtgtgacctactgcccgcactgtgacggtccgctgtttaaaggtaaacgcgtagcggtg
atcggcggcggtaactccggcgtggaagcggctatcgacctggcggggattgtggaacat
gtgaccctgctggagttcgcgccagagatgaaggccgaccaggttctgcaggataaagtt
cgcagcctgaaaaacgtcgacatcatcctgaacgcgcagaccacggaagtgaagggcgac
ggcagcaaagtgaccggcctggaataccgtgaccgcatcagcggcgacgtgcacagcgtt
cagctttcggggattttcgtgcagattggtctgctgccaaacaccacctggctggaaggc
gcgattgagcgcaaccgtatgggcgagatcatcattgatgcgaaatgtgaaaccagcgta
aaaggcgtcttcgccgcaggtgactgtacgaccgtgccgtacaaacagatcatcattgcc
acgggcgaaggtgcgaaagcgtccctgagttcgtttgactatctgattcgcaccaaaacc
gcataa

DBGET integrated database retrieval system