KEGG   Enterobacter sp. ODB01: A4308_14340Help
Entry
A4308_14340       CDS       T06363                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
end  Enterobacter sp. ODB01
Pathway
end00480  Glutathione metabolism
end01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:end00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A4308_14340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:end02000]
    A4308_14340
Enzymes [BR:end01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A4308_14340
Transporters [BR:end02000]
 Other transporters
  Pores ion channels [TC:1]
   A4308_14340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_N_2 GST_C_3 GST_N_3 GST_N GST_C_6
Motif
Other DBs
NCBI-ProteinID: AMZ78117
LinkDB All DBs
Position
complement(3003726..3004331)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFLAINPKGQVPALLLDDG
TLLTEGVAIMQFLADNVPDRQLLAPTGSIARYKTLEWLNYIATELHKGFTPLFRPDTPEE
YKPTLRALLEKKLQYVNASLKDDQWICGSRFTIADAYLFTVLRWARAVKLNMEGLDHITS
YMTRMAERPAVAAALKAEGLS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggcgcgtgctctcttgcttcccatatcaccctgcgcgag
agcggcaaagatttcacgctcgatggcgttgatctgatgaaaaagcgtctggagaatggc
gatgatttccttgctattaacccgaagggacaagttccagcgctgttgctggatgacgga
actctgctgacagaaggcgttgccatcatgcaattcctggcggacaacgtaccggatcgc
cagcttcttgcccccaccggcagcattgcacgttataagaccctggagtggttaaactat
atcgctaccgagttacataaaggctttactcccctgttccgcccggatacgccggaagag
tacaaaccgaccctgcgcgcgcttcttgagaaaaagctgcagtatgtaaacgcgtcgctg
aaagacgatcagtggatttgtggttcccgtttcacgattgccgatgcctatctgtttacc
gtgctgcgctgggcgcgggcggttaagctcaatatggaagggttagaccatattacatcg
tatatgacccgtatggcggagcgccctgctgtggctgcggcgctgaaagcggaaggtctt
agctaa

DBGET integrated database retrieval system