KEGG   Enterococcus faecalis 7L76: ENT_12050Help
Entry
ENT_12050         CDS       T02585                                 

Definition
(GenBank) yjeF C-terminal region, hydroxyethylthiazole kinase-related
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
ene  Enterococcus faecalis 7L76
Brite
KEGG Orthology (KO) [BR:ene00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ENT_12050
Enzymes [BR:ene01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     ENT_12050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: CBL31799
LinkDB All DBs
Structure
PDB: 

Position
1160143..1161018
Genome map
AA seq 291 aa AA seqDB search
MRYLSKDILEEVITQRPSDSYKSNFGRVVLIGGNRQYGGAIIMSTEACINSGAGLTTVIT
DVKNHGPLHARCPEAMVVGFEETALLTDVVEQAEVILIGPGLGLDATAQQILKMVLAQHQ
KQQWLIIDGSAITLFSQGNFSLTYPEKVVFTPHQMEWQRLSHLPIEQQTLANNQRQQAKL
GSTIVLKSHHTTIFHAGEPFQNTGGNPGMATGGTGDTLAGIIAGFLAQFKPTIETIAGAV
YLHSLIGDDLAKTDYVVLPTKISQALPTYMKKYAQPHTAPDSELLEQKRSR
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatttaagcaaggacattttagaggaagtcatcactcaacgcccctccgactct
tataaaagtaattttgggcgtgttgtattaatcggaggaaaccgacaatatggcggagcc
atcatcatgagtaccgaagcgtgtatcaatagtggcgctggtctcaccactgtgattact
gatgttaaaaatcacgggcctttacatgcaagatgcccagaagcgatggtcgtgggcttt
gaagaaacagcccttctgacggacgtcgtagagcaagcggaggttattttaattggtcca
ggtttaggcttagatgctactgcacaacaaatattaaagatggtactcgcccaacatcaa
aaacaacaatggttaattatcgatggctcagcaattaccctgtttagccaaggtaatttt
tcccttacctatcctgaaaaagttgttttcacacctcatcaaatggaatggcaacgtttg
agtcacttacctatcgagcaacaaacactggcaaataaccagcgccaacaagcaaaatta
ggcagtacgattgttttaaaaagtcatcacaccacaattttccacgcaggagaacctttt
caaaatacaggtggcaaccctgggatggctactggcggaactggggataccttggctggc
atcattgctggttttttagctcagtttaagccgacaattgaaaccattgctggcgccgtc
tacttacacagtctcattggagatgatttggccaaaactgactatgttgttttaccaacg
aagattagtcaagccttgccgacatatatgaaaaaatatgcccagccacacactgcacct
gattctgaactattagaacagaagcgttcgagataa

DBGET integrated database retrieval system