KEGG   Enterobacter sp. FY-07: AKI40_0350Help
Entry
AKI40_0350        CDS       T04405                                 

Definition
(GenBank) aminotransferase class-III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
enf  Enterobacter sp. FY-07
Pathway
enf00250  Alanine, aspartate and glutamate metabolism
enf00410  beta-Alanine metabolism
enf00640  Propanoate metabolism
enf00650  Butanoate metabolism
enf01100  Metabolic pathways
enf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:enf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AKI40_0350
   00650 Butanoate metabolism
    AKI40_0350
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AKI40_0350
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AKI40_0350
Enzymes [BR:enf01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AKI40_0350
Amino acid related enzymes [BR:enf01007]
 Aminotransferase (transaminase)
  Class III
   AKI40_0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AMO46778
UniProt: A0A127KWY3
LinkDB All DBs
Position
375481..376746
Genome map
AA seq 421 aa AA seqDB search
MKNNELHQRRLQATPRGIGVMCGFYAEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VMAAVEKQLQAFTHTAYQIVPYESYVSLAERINARVPVTGPAKTAFFSTGAEAVENAVKI
ARAYTRRPGVITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSIYHAQYPNTLHGVSTG
DALKSLERIFKADIAPDQVAAILLEPVQGEGGFNVAPADFMQALRKLCDSHGILLIVDEV
QSGFARTGKLFASEYYDVKPDLITMAKSLAGGLPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEDLCERANHLGKHLVEVLNNAKTQCPYIAEIRAQGSMVAVEFND
PNTGAPSAEFTKQVQDKALAAGLLLLTCGVYGNVIRFLYPLTIPEVQFRKALDILQQSLT
H
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgaattacatcaacgccgtttacaggcgacgccgcgtggaattggggtg
atgtgcgggttttacgccgaaaaagcggagaacgccacgctgtgggatgtggaaggcaac
gaagtgatcgattttgccgccggtattgcagtgctgaataccggacatcgccatccgaaa
gtgatggcggcggtagaaaaacagctgcaggcatttacgcatactgcctaccaaatcgtg
ccttacgaaagctatgtgtcactggcggagcgcatcaatgcgcgcgtgccggtcactggc
ccggccaaaacagcgttcttctcaacgggggcggaagcggtggaaaacgcggtgaaaatc
gcccgtgcatatacccggcgcccgggtgttatcaccttcggcggcggtttccatggccga
acctttatgaccatggccctgactggcaaagtcgccccttataaaatcggctttggcccg
ttcccgggttcgatttaccacgcgcagtacccaaacaccttgcacggcgtgagcacgggc
gatgcgctgaaaagcctggaacgcatttttaaagccgatatcgcaccggatcaggttgcc
gctatcctgctggaaccggtacagggcgaagggggctttaatgtcgcacctgcggacttt
atgcaagcgctgcgtaagttgtgtgatagccacggtattttattgattgtcgatgaagtc
cagagcgggtttgcccgtaccggcaaactctttgcctcggagtattacgacgtcaaacct
gacctgatcaccatggcgaagagtctggcgggcggcttgccgctgtcggcggttgcggga
cgcgcggaggtcatggacgctcctgcacctggcgggctgggcggcacctatgcaggtaac
ccgctggcggtggcggcagcgcatgcggtgctggatgttatcgaagaagaggatttgtgc
gaacgcgctaatcacctgggtaaacatctggtggaagtgttgaacaacgccaaaacgcag
tgcccctatatcgcggagattcgtgcgcaggggtcgatggtggcggtggagtttaacgat
ccgaacaccggcgcaccgtcggcagaatttacgaagcaggtgcaggataaggcgctggcg
gcagggctgttactgctgacctgcggcgtttacggcaacgtgatccgtttcctctatcca
ttgaccattccggaagtccagttccgtaaagcgctggatattctccagcagtcgctgacg
cactaa

DBGET integrated database retrieval system