KEGG   Enterobacter sp. FY-07: AKI40_1956Help
Entry
AKI40_1956        CDS       T04405                                 

Definition
(GenBank) Alpha-amylase, cytoplasmic
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
enf  Enterobacter sp. FY-07
Pathway
enf00500  Starch and sucrose metabolism
enf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AKI40_1956
Enzymes [BR:enf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AKI40_1956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: AMO48365
UniProt: A0A127L1L4
LinkDB All DBs
Position
complement(1991097..1992770)
Genome map
AA seq 557 aa AA seqDB search
MIRLSSITRLVCFVHSSPSFLTRNTTWLCLRILLPRFCKNALSHSVFKISSILPESYSGA
PNMKNPTLLQTFHWYYPDGGKLWPELRERAAGFNDIGINMVWLPPAYKGASGGYSVGYDS
YDLFDLGEFDQKGSVATKYGDKTQLLAAINALKENNIAVLLDVVVNHKMGADEKEAIRVQ
RVNAQDRTQIDDEIIECEAWTRYTFPTRAGQYSQFIWDFKCFSGIDHIENPDEDGVFKIV
NDYTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMDQTGCDGFRLDAVK
HIPAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVGKLQQYIDQVDGKTMLFDAPLHMKFHE
ASKLGRDYDMSQIFIGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLR
ENGVPSIFYPDLYGAHYEDTGGDGETYAVDMPVIDQLDQLILARQRFAHGVQTLWFDHPN
CIAFSRSGTDDDPGCVVVLSNGDDGEKHMTLGENYGHKTWRDFLGNRDEWVTTDESGAGV
FTCNGGSVSVWIIEDVL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
gtgatacgtttgtcgtcaatcacccgcctggtttgttttgttcactcctccccctctttt
ttgacacgtaataccacctggctttgcctgcgcatccttcttccccggttttgcaaaaat
gcgctttctcattctgtttttaaaatctcatccatacttccagagtcttactctggagca
ccgaatatgaaaaaccccaccctgttacagacctttcattggtattaccccgatggcggc
aaactctggccggaactgcgcgaacgcgctgcgggctttaacgatattggcattaacatg
gtctggcttcccccggcgtataaaggtgcatccggcggctactcggtgggttacgacagt
tatgacctgtttgacttaggcgagtttgaccaaaaagggtctgtagccaccaaatacggt
gataaaacacagctactggccgccatcaatgcattgaaagagaacaatatcgctgtgctg
ttggatgtggtggtcaaccacaaaatgggggctgacgaaaaagaagccattcgtgttcag
cgggttaatgcgcaggatcgcacacagattgatgatgaaatcatcgaatgtgaggcctgg
acacgctatacctttccgactcgcgccgggcaatactcgcaatttatctgggatttcaaa
tgtttcagcggtatcgaccatattgaaaatccggatgaagacggggtgttcaaaatcgtc
aacgattacaccggtgagggctggaacgatcaagtggacgacgaaatgggcaacttcgac
tatctgatgggtgaaaatattgattttcgcaaccatgccgtaaccgaagagatcaagtac
tgggcgcggtgggtaatggatcaaaccggatgcgatggctttcgcctggacgcggtaaaa
catattcccgcctggttctacaaagagtggatcgaacatgtgcaggaagttgcgccaaag
ccgttgttcatcgttgcggaatactggtcacacgaggtaggaaagctacagcaatatatc
gatcaggtcgacggtaaaaccatgctgtttgatgccccactgcatatgaaatttcatgaa
gcgtcgaaactggggcgcgattatgacatgagccagatttttatcggcaccctggttgaa
gctgacccctttcatgcggtgacgctggtcgccaaccatgacacacagccgttgcaggcg
ctggaagcaccggtggaagcctggtttaaacccctggcctatgccctgatcctgctgcgg
gaaaatggcgtgccctcgatcttctaccctgacctgtatggtgcccattatgaggatacc
ggcggtgatggagaaacgtacgctgtggatatgccggttatcgaccaactcgatcagttg
attctcgcccgccagcgctttgcacatggggtacaaacgctgtggtttgatcaccccaac
tgtattgctttcagccgcagcggcaccgacgacgatcccggctgcgtggtggtactatcc
aacggtgatgatggcgaaaagcacatgacgctgggcgagaattatggccataaaacctgg
cgtgactttctgggcaaccgcgacgaatgggtgacgaccgatgagagcggcgccggggtg
tttacctgcaatggcggcagcgtcagcgtgtggataatcgaggatgtgctctga

DBGET integrated database retrieval system