KEGG   Enterobacter sp. FY-07: AKI40_2099Help
Entry
AKI40_2099        CDS       T04405                                 

Gene name
ahpF
Definition
(GenBank) Strongly alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
enf  Enterobacter sp. FY-07
Brite
KEGG Orthology (KO) [BR:enf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AKI40_2099 (ahpF)
Enzymes [BR:enf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AKI40_2099 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase Glutaredoxin FMO-like DAO AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AMO48504
LinkDB All DBs
Position
2113724..2115289
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVSFKEDNSLAV
RKPSFLITNPGSTQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDLDGDFA
FETYYSLSCHNCPDVVQALNLMAVLNPRITHTAIDGGTFQNEITDRNVMGVPAVFVNGKE
FGQGRMTLAEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVAEYDVDVIDSQSASKLTPAAVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEEQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQNKLRSLKNVDIVLNAQTTEVKGD
GSKVTGLEYRDRVSGDVHHVALAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDTRCETSV
KGVFAAGDCTTVPYKQIIIASGEGAKASLSAFDYLIRTKSA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccaatatgaaaacgcaactcaaggcctaccttgagaaactgaccaaacct
gttgagctgattgctacgctggatgacagcgcgaaatcggcagaaatcaaggaactgctg
gctgaaatcgcggaactgtcagacaaggtctcctttaaagaagacaacagcctggcggtg
cgtaagccgtcattcctgatcactaaccctggctctactcaagggccacgctttgccggt
tcgccgctgggtcatgaatttacctccctggtgctggcgctgctgtggacgggtggtcat
ccgtcaaaagaggcgcaggcgttgcttgagcagatccgcgatctcgacggggattttgcc
tttgaaacctattattcgctctcctgccataactgcccggacgtggtgcaggcgctgaac
ctgatggcggtgctgaacccgcgtatcacgcatacggcaattgatggcggaactttccag
aacgaaatcaccgatcgtaacgtgatgggtgttccggcggtgtttgtgaacggcaaagag
tttggccaggggcgtatgacgctggcggagatcgtggccaaaattgataccggtgcagag
aaacgtgcggcggaagaactgaataaacgcgatgcctacgatgtgctgattgtgggttcc
ggcccggcaggcgcagcggcggcaatctactcggcccgtaaaggcattcgtaccggtctg
atgggcgagcgtttcggcggtcaggtgctggatacggtcgacattgaaaactatatctcg
gttccgaaaaccgaaggtcagaaactggctggcgcgttgaaagcgcatgtggctgagtat
gatgtggacgtgattgacagtcagagtgccagcaaactgacgcccgcggcggttgaaggc
ggcctgcatcagattgaaaccgcctccggcgcggtgctgaaagcacgcagcatcatcatt
gccaccggcgcgaaatggcgcaacatgaacgtaccgggtgaagagcaatatcgcaccaaa
ggcgtgacctactgcccgcattgcgacggcccgttgtttaaaggtaaacgcgtggcggtg
attggcggcggtaactccggtgtggaagcggctatcgatctcgccgggattgttgagcac
gtcacgttgctggagttcgctccagagatgaaagcggatcaggtgttgcagaataagctg
cgtagcctgaaaaatgtcgacatcgttctgaatgcgcagaccaccgaagtgaaaggtgac
ggcagcaaagtgaccggtcttgagtaccgcgatcgtgtcagtggtgatgtgcaccatgtg
gcgctggcggggatctttgtgcagattggtctgctgccgaacaccacctggctggaaggc
gcaattgagcgcaaccgcatgggtgagatcattatcgatacccgttgtgaaaccagcgtg
aaaggtgtgtttgcggccggtgactgcacgacagtgccgtacaaacagatcattattgct
tcgggtgagggggctaaagcgtcgctgagcgcgtttgactacctcattcgcacaaaaagt
gcgtaa

DBGET integrated database retrieval system