KEGG   Enterobacter sp. FY-07: AKI40_3967Help
Entry
AKI40_3967        CDS       T04405                                 

Definition
(GenBank) Beta-lactamase/D-ala carboxypeptidase, penicilling binding protein
  KO
K18988  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase [EC:3.4.16.4 3.4.21.-]
Organism
enf  Enterobacter sp. FY-07
Brite
KEGG Orthology (KO) [BR:enf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:enf01002]
    AKI40_3967
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:enf01011]
    AKI40_3967
Enzymes [BR:enf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AKI40_3967
   3.4.21  Serine endopeptidases
    3.4.21.-  
     AKI40_3967
Peptidases [BR:enf01002]
 Serine Peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   AKI40_3967
Peptidoglycan biosynthesis and degradation proteins [BR:enf01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AKI40_3967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AMO50344
UniProt: A0A127L778
LinkDB All DBs
Position
4035634..4036779
Genome map
AA seq 381 aa AA seqDB search
MLFSAMLCALSLTTARAAQHSPDPVFASDIVDRYANHIYFGSGATGMAIVVIDGNQRVFR
SYGETRPGNNVRPQLDSVIRIASLSKLMTSEMLVKLLDQGIVRLDDPLSKYAPPGARVPT
YQGTPITLVNLATHTSALPREQPGGAAHRDVFVWPTREQRWNWLSTATLKFAPGTQAAYS
NLAFDLLADALAKAAGKPYPQLFEDQITRPLGMKDTTFTPSPDQCKRLMVAEKGASPCNN
TLAAVGSGGVYSTPGDMMRWMQQFLSSDFYSRNSQADRMQTLIYPRNQLTKVIGMDVPGK
ADALGLGWVYMAPKEGHPGIIQKTGGGGGFITYMAMVPQHNVGVFVVITRSPLTRFTNMS
DGVNDLVSELSNNKPHVVPAS
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgcttttttctgcgatgctgtgcgcactcagcctgaccaccgcccgggcggcgcaacac
tctcctgacccggtttttgcttcggatatcgtcgatcgctacgccaaccatatttacttt
ggcagcggcgcgacaggaatggcgatcgtcgtgattgacggaaatcagcgcgtattcaga
agttatggcgaaacccgaccgggtaataatgtacgcccacaactggactcggtgattcgt
attgcctcactgtcgaagctgatgaccagcgagatgctggtgaaactgctcgatcaaggt
atcgtgcgtctggacgatcccttaagtaaatatgcaccgccgggcgctcgcgtcccgact
taccagggcacgcccattacgctggtgaatctcgccacgcacaccagcgccctgccccgt
gaacaacccggcggcgcggcgcaccgcgatgtgtttgtctggccaacgcgtgaacagcgc
tggaactggctctcaaccgccacgctaaaattcgcgcccggtacgcaggccgcctactcc
aacctggcgtttgatctgttggccgatgcgctggcaaaagcggcggggaaaccgtatccc
caactgtttgaagatcagatcacgcgcccgctgggcatgaaagacaccacctttacgccc
tcaccggatcagtgcaaacgcctgatggtggccgaaaaaggtgccagcccctgtaacaat
acgctggcggcagtcggcagtggcggtgtttactccacgcccggcgacatgatgcgctgg
atgcaacagttcctctcgtcggatttctactcccgcaacagtcaggccgaccgtatgcag
acgctgatttacccgcgtaatcagttgacgaaagtgatcgggatggatgtccccggtaaa
gcggacgcgctgggtctgggctgggtgtatatggcaccgaaagaggggcaccctggcatc
attcagaaaaccggtggcggcggtggatttatcacttatatggccatggtgccacagcat
aacgtcggagtgtttgtggtgatcacccgctcgccgctgacgcgctttaccaatatgagc
gacggcgtcaacgacctggtcagtgaactgagcaacaacaaaccgcacgtggttcccgcc
tcctga

DBGET integrated database retrieval system