KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_06145Help
Entry
A3UG_06145        CDS       T02159                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Brite
KEGG Orthology (KO) [BR:enl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A3UG_06145
Enzymes [BR:enl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A3UG_06145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO FAD_binding_3 Thi4 NAD_binding_8 Glutaredoxin K_oxygenase AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: AFM58970
LinkDB All DBs
Position
1346243..1347808
Genome map
AA seq 521 aa AA seqDB search
MLDTTMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSPKVTFKEANDLAV
RKPSFLITNPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFT
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMGVPAVFLNGQE
FGQGRMTLSEIVAKVDTGAEKRAAEALNQRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYAVDVIDSQSASKLVPAVVEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLNNVDIVLNAQTTEVKGD
GSKVTGLAYRDRVSGDVHSVQLSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactacgatgaaaacccagctcaaggcataccttgagaaattgaccaaacct
gttgagctgattgccacgctggacgacagcgctaaatcggcagaaatcaaggaactgctg
gctgagatcgccgagctgtcaccgaaagtgaccttcaaagaagcgaacgatctcgccgtg
cgtaagccatctttcctgatcactaacccgggctctgaccaggggccgcgttttgccggt
tcaccactgggccacgaatttacctcactggtgctggctctgctgtggaccggtgggcat
ccgtcgaaagaggcgcaggcgctgctggagcagatccgcgatatcgacggggatttcacc
tttgaaacctactattcgctctcctgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgtcggtcctgaacccgcgtattaaacacacggcgattgatggcggcaccttccag
aacgagatcaccgatcgcaacgtgatgggcgttccggcagtgttcctgaatggtcaggag
tttggccagggccgtatgaccctgtcagaaattgtggccaaagtggataccggcgccgaa
aaacgtgccgcagaagcgctgaaccaacgcgatgcgtatgatgtgctgattgtcggctct
ggcccggcaggcgccgcggcagcggtctattctgcacgtaaaggtattcgtaccggcctg
atgggcgaacgctttggcggccaggtgctggataccgtggatatcgaaaactacatctct
gtgccgaagaccgaaggtcagaaactggctggcgcactcaaggcgcacgtcagtgattac
gcggtggatgtgatcgacagccagagcgccagcaagctggttccggctgtggtggaaggc
ggtttacatcagattgaaacggcttccggcgcggtgctgaaagcccgcagcattatcatt
gctaccggcgcgaaatggcgcaacatgaacgtgccgggtgaagatcagtatcgcaccaaa
ggcgtgacctactgcccgcactgcgacggtccgctttttaagggcaaacgcgtggcggtg
attggcggcggtaactccggtgtcgaagcggctatcgacctggcgggcattgttgaacac
gttaccctgctggagtttgcgccagagatgaaggcagaccaggttctgcaggataaagta
cgcagcctgaacaacgtcgacatcgtgctgaatgcgcagaccacggaagtgaagggcgac
ggcagtaaagtcaccggtctggcgtaccgcgaccgcgtcagtggcgatgtgcatagcgtt
cagctttcggggatcttcgtgcagattggtctgctgcccaacaccacctggctggaaggc
gccattgaacgtaaccgcatgggtgaaatcatcatcgatgcgaagtgtgaaaccagcgtg
aagggcgtgtttgcggcgggcgactgtactaccgtgccgtacaagcagatcatcatcgcc
accggtgaaggggcgaaagcgtctctgagcgcgttcgactacctgattcgcaccaaaacc
gcataa

DBGET integrated database retrieval system