KEGG   Enterobacter cloacae subsp. dissolvens SDM: A3UG_14365Help
Entry
A3UG_14365        CDS       T02159                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
enl  Enterobacter cloacae subsp. dissolvens SDM
Pathway
enl00500  Starch and sucrose metabolism
enl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:enl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A3UG_14365
Enzymes [BR:enl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A3UG_14365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: AFM60599
LinkDB All DBs
Position
3082837..3084324
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPAGGELWREVAALAPNLNEIGINMIWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVATKYGDKAQLLEAIDALKSNDIAVLLDVVVNHKMGADEKEQVRVQRV
NEQDRTQIDDEIIECEAWTRYTFPVRAGQYSQFVWDYKCFSGIDHIENPNEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTGCDGFRLDAVKHI
PAWFYKEWIEHVQEVATQPLFIVAEYWSHEVDKLQAYINQVEGKTMLFDAPLQMKFHEAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGASYDDTGGDGETYHIDMPVIEQLHELILARQRFAHGVQTLFFDHPNCI
AFSRNGTDEDPGCVVVMSNGDDGEKVICLGENYGNKTWRDFLGNREETVTTAADGEGTFT
CKGGSVSVWVIEDAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccaccctgttacaatgttttcactggtattaccctgcaggcggtgaattg
tggcgagaggtcgcggcattagcccccaatcttaacgaaatcggcatcaatatgatctgg
ctgcccccggcctataaaggcgcatccggcgggtattcggtcgggtatgattcatacgac
ctgttcgatctcggcgagtttgaccagaaagggagcgtggccaccaaatacggtgataaa
gcccaactgctggaagccattgatgcgctcaagagcaatgacatcgcggtgctgctggat
gtggtggtcaaccacaaaatgggcgccgatgagaaagagcaggttcgcgttcagcgcgtg
aacgaacaggaccgcacgcaaatcgatgatgagatcatcgagtgcgaagcctggacccgc
tacaccttccctgtccgcgccggccagtattcgcagtttgtctgggattacaaatgcttc
agcggcatcgaccacatcgaaaaccccaatgaggatggcatcttcaaaatcgtcaatgat
tacaccggcgaaggctggaacgatcaggttgatgatgaaatgggtaatttcgactatctg
atgggcgaaaatatcgattttcgtaaccatgccgtgacggaggagatcaagtactgggcg
cgctgggtcatggaacaaaccggctgcgacggattccgcctggatgcggtcaaacacatc
cccgcctggttctataaggagtggattgaacacgtccaggaagtggcgacgcagccgctg
tttatcgtcgcggaatactggtcgcacgaggtggataaactgcaggcctatattaatcag
gtcgagggtaaaacaatgctgtttgatgcccccctgcagatgaaattccacgaggcctcg
cgccagggacgggactacgacatgagccagattttcaccggcacgctggtggaggccgat
ccgttccacgcggtgacgctggttgccaaccatgatacccagccgttgcaggcgcttgaa
gcgccggtggaagcctggtttaaaccgctggcctacgccctgatcctgctgcgggaaaat
ggcgtgccgagcgtgttttatcccgacctcttcggcgccagctatgacgataccggggga
gacggtgaaacctaccacattgatatgccggtgattgagcagcttcatgagctgatcctc
gcccgtcagcgctttgcccacggcgtgcagacgctgttttttgaccaccctaactgtatc
gcgttcagccgcaatggcaccgatgaggatcccggctgtgtggtggtgatgtccaatggg
gatgatggcgagaaggtgatctgccttggggaaaactacggcaacaaaacctggcgtgat
tttcttggcaatcgtgaagaaacggtcaccaccgcggcggatggcgaagggacttttacc
tgcaaaggtggaagcgtgagtgtgtgggtgattgaggatgcgttgtag

DBGET integrated database retrieval system